![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lus10005925 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 86aa MW: 9759.2 Da PI: 7.2529 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 80.3 | 3.1e-25 | 12 | 72 | 1 | 61 |
HHHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTT CS
HSF_DNA-bind 1 aFlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYg 61
+Fl k+ye++ed++ ++++sws+ n+fvv++ ef+k++Lpk+Fkh+nf+SFvRQLn+Y
Lus10005925 12 SFLCKTYELVEDPSPDSVVSWSSGDNNFVVWNVPEFQKQLLPKFFKHNNFSSFVRQLNTYV 72
59**********************************************************5 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00415 | 9.2E-19 | 9 | 83 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene3D | G3DSA:1.10.10.10 | 3.9E-26 | 9 | 75 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SuperFamily | SSF46785 | 1.36E-23 | 11 | 75 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| PRINTS | PR00056 | 5.7E-16 | 13 | 36 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Pfam | PF00447 | 2.5E-21 | 13 | 75 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 5.7E-16 | 51 | 63 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 5.7E-16 | 64 | 76 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 86 aa Download sequence Send to blast |
MVDVAVGSIV PSFLCKTYEL VEDPSPDSVV SWSSGDNNFV VWNVPEFQKQ LLPKFFKHNN 60 FSSFVRQLNT YVCRRSSLLI PLGFW* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d5u_B | 9e-19 | 8 | 75 | 24 | 91 | Heat shock factor protein 1 |
| 5d5v_B | 9e-19 | 8 | 75 | 24 | 91 | Heat shock factor protein 1 |
| 5d5v_D | 9e-19 | 8 | 75 | 24 | 91 | Heat shock factor protein 1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lus10005925 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009118959.1 | 6e-29 | PREDICTED: heat stress transcription factor A-1e-like | ||||
| Refseq | XP_020889453.1 | 6e-29 | heat stress transcription factor A-1e | ||||
| Refseq | XP_022742783.1 | 6e-29 | heat stress transcription factor A-1e-like | ||||
| Swissprot | Q9SCW5 | 1e-29 | HFA1E_ARATH; Heat stress transcription factor A-1e | ||||
| TrEMBL | A0A1R3JP28 | 6e-29 | A0A1R3JP28_9ROSI; Heat shock factor (HSF)-type, DNA-binding protein | ||||
| STRING | Lus10005925 | 5e-56 | (Linum usitatissimum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1592 | 33 | 95 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G02990.1 | 6e-24 | heat shock transcription factor A1E | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Lus10005925 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




