![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lus10006119 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 114aa MW: 12899.8 Da PI: 4.5733 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 55.4 | 2.1e-17 | 9 | 60 | 1 | 53 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka 53
lp G+rF+Ptdeel+++yL+ k++g++ e+ ++++e+d++++ePwdLp++v++
Lus10006119 9 LPLGYRFQPTDEELITHYLRLKINGRDSEV-DAVPEIDVCRWEPWDLPAQVYT 60
699************************999.99***************64443 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 4.58E-18 | 5 | 63 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 17.31 | 9 | 113 | IPR003441 | NAC domain |
| Pfam | PF02365 | 5.1E-8 | 10 | 68 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 114 aa Download sequence Send to blast |
MSALAVKSLP LGYRFQPTDE ELITHYLRLK INGRDSEVDA VPEIDVCRWE PWDLPAQVYT 60 IDEKENDKTR RIKISANIAG LEMFAGLEML LLNSQELDCQ LRGCYPFGRN GVV* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP) (PubMed:18443413, PubMed:24329768). Calmodulin-regulated transcriptional repressor. Binds several synthetic promoters with randomly selected binding sites (PubMed:17947243). Functions synergistically with SNI1 as negative regulator of pathogen-induced PR1 expression and basal resistance to a virulent strain of P.syringae. Binds directly to the promoter of the PR1 gene (PubMed:22826500). Acts as positive regulator of innate immunity. Involved in the effector-triggered immunity (ETI) induction of immunity-related gene expression (PubMed:24329768). Mediates osmotic stress signaling in leaf senescence by up-regulating senescence-associated genes (PubMed:18443413). {ECO:0000269|PubMed:17947243, ECO:0000269|PubMed:18443413, ECO:0000269|PubMed:22826500, ECO:0000269|PubMed:24329768}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lus10006119 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001280864.1 | 4e-25 | uncharacterized LOC103438687 | ||||
| Refseq | XP_009360232.1 | 4e-25 | PREDICTED: NAC domain-containing protein 14 | ||||
| Swissprot | F4JN35 | 3e-24 | NTL9_ARATH; Protein NTM1-like 9 | ||||
| TrEMBL | A0A0M4FLS3 | 8e-24 | A0A0M4FLS3_MANES; NAC transcription factors 88 | ||||
| TrEMBL | D9ZJA7 | 9e-24 | D9ZJA7_MALDO; NAC domain class transcription factor | ||||
| STRING | Lus10006119 | 1e-79 | (Linum usitatissimum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF11433 | 17 | 39 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G35580.2 | 1e-26 | NAC transcription factor-like 9 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Lus10006119 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




