![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lus10023484 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 169aa MW: 18068.2 Da PI: 7.5054 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 177.1 | 1.7e-55 | 25 | 118 | 1 | 94 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94
vreqdrflPian+srimkk lPan+ki+k+ak+tvqecvsefisf+tseasdkcq+ekrktingddllwa+atlGfedy+eplk+yl++yre +
Lus10023484 25 VREQDRFLPIANISRIMKKGLPANGKIAKEAKDTVQECVSEFISFITSEASDKCQKEKRKTINGDDLLWAMATLGFEDYIEPLKAYLARYREGD 118
69*****************************************************************************************965 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 9.2E-53 | 22 | 133 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.17E-39 | 28 | 127 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 4.7E-28 | 31 | 95 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 3.3E-21 | 59 | 77 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 62 | 78 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 3.3E-21 | 78 | 96 | No hit | No description |
| PRINTS | PR00615 | 3.3E-21 | 97 | 115 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 169 aa Download sequence Send to blast |
MAENPGSPAG GSHDSGGEHS PHSGVREQDR FLPIANISRI MKKGLPANGK IAKEAKDTVQ 60 ECVSEFISFI TSEASDKCQK EKRKTINGDD LLWAMATLGF EDYIEPLKAY LARYREGDAK 120 GSARGEGSAA KRDPMGGNGM PAQNTQMTLN MVCAGTRAAY GSSFHAWQ* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 2e-46 | 25 | 116 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 2e-46 | 25 | 116 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lus10023484 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU830845 | 0.0 | EU830845.1 Linum usitatissimum clone LU0032C11 mRNA sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012073728.1 | 2e-89 | nuclear transcription factor Y subunit B-1 isoform X2 | ||||
| Refseq | XP_020535556.1 | 1e-89 | nuclear transcription factor Y subunit B-1 isoform X4 | ||||
| Swissprot | Q8VYK4 | 8e-70 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | A0A067LFV2 | 2e-87 | A0A067LFV2_JATCU; Uncharacterized protein | ||||
| STRING | Lus10023484 | 1e-124 | (Linum usitatissimum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2545 | 33 | 82 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G37060.3 | 3e-72 | nuclear factor Y, subunit B8 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Lus10023484 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




