![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lus10024515 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
| Family | NF-YC | ||||||||
| Protein Properties | Length: 135aa MW: 14336.1 Da PI: 7.5211 | ||||||||
| Description | NF-YC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YC | 112.8 | 1.7e-35 | 22 | 101 | 19 | 98 |
NF-YC 19 helPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivpr 98
h+lPlarikki+k+ +dvkmis eaP+++skacelfi elt rsw+ + + krrtl+k d+a+a++ t++fdflv v +
Lus10024515 22 HSLPLARIKKIMKSGDDVKMISGEAPIVFSKACELFIEELTRRSWMVTVQGKRRTLHKDDVATAIATTEVFDFLVGLVGT 101
99************************************************************************988765 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 1.26E-27 | 15 | 95 | IPR009072 | Histone-fold |
| Gene3D | G3DSA:1.10.20.10 | 3.8E-33 | 19 | 86 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 5.6E-21 | 23 | 86 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 135 aa Download sequence Send to blast |
MRQPGTYSKF LSGGVSGRTG PHSLPLARIK KIMKSGDDVK MISGEAPIVF SKACELFIEE 60 LTRRSWMVTV QGKRRTLHKD DVATAIATTE VFDFLVGLVG TNTTNNGSGS ATNSSSVGNP 120 TEEEESTDPA VWSG* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_B | 9e-34 | 22 | 99 | 16 | 93 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT C-3 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the regulation of flowering time under long day (LD) conditions. Functions as repressor of flowering, independently of HD1 and GHD7. Controls flowering time by negatively regulating the expression of EHD1 and HD3A (PubMed:26542958). Component of the NF-Y/HAP transcription factor complex (By similarity). {ECO:0000250, ECO:0000269|PubMed:26542958}. | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lus10024515 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Circadian-regulation under long day (LD) conditions. Expression increases at the end of the dark period, peaks in the beginning of the light period and gradually decreases during daytime. {ECO:0000269|PubMed:26542958}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_012846523.1 | 5e-58 | PREDICTED: nuclear transcription factor Y subunit C-1-like | ||||
| Refseq | XP_021676891.1 | 5e-58 | nuclear transcription factor Y subunit C-3-like | ||||
| Swissprot | A6BLW4 | 1e-33 | NFYC2_ORYSJ; Nuclear transcription factor Y subunit C-2 | ||||
| Swissprot | Q8LCG7 | 1e-33 | NFYC2_ARATH; Nuclear transcription factor Y subunit C-2 | ||||
| TrEMBL | A0A022QR29 | 1e-56 | A0A022QR29_ERYGU; Uncharacterized protein | ||||
| STRING | Lus10024515 | 2e-94 | (Linum usitatissimum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF10559 | 28 | 41 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G56170.2 | 5e-33 | nuclear factor Y, subunit C2 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Lus10024515 |




