PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Lus10031767

Organism

Linum usitatissimum

Taxonomic ID

4006

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum

Family

NAC

Protein Properties

Length: 217aa MW: 24636.2 Da PI: 5.198

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Lus10031767	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	160.7	5.5e-50	33	159	2	128
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 pGfrFhPtdeel+++yL++kv++k+l++ e ik+vdiyk++PwdLp+++ ++ke yfF++r +ky+++ r+nr+t sg+Wkatg dk+v+s +++ Lus10031767 33 LPGFRFHPTDEELLSFYLRRKVDNKPLSI-ELIKQVDIYKYDPWDLPRSTGDGDKEGYFFCRRGRKYRNSIRPNRVTGSGFWKATGIDKPVYSMaGDN 129 59*************************.89***********88889999*********************************996777 PP NAM 99 lvglkktLvfykgrapkgektdWvmheyrl 128 +glkktLv+y+g+a kg+ktdW+mhe+rl Lus10031767 130 CIGLKKTLVYYRGSAGKGTKTDWMMHEFRL 159 8*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	48.908	32	181	IPR003441	NAC domain
SuperFamily	SSF101941	3.53E-53	33	168	IPR003441	NAC domain
Pfam	PF02365	3.7E-25	34	159	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 217 aa Download sequence Send to blast
MNSSTVTSDD NCDHDHRDRE EEEEEEEDDD VSLPGFRFHP TDEELLSFYL RRKVDNKPLS 60 IELIKQVDIY KYDPWDLPRS TGDGDKEGYF FCRRGRKYRN SIRPNRVTGS GFWKATGIDK 120 PVYSMAGDNC IGLKKTLVYY RGSAGKGTKT DWMMHEFRLP TSDQTGTNNI NGYITSSESS 180 KLTSAQEASH VPLKQLAGQD GKEPVKWAGW VSYELG*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	2e-46	23	187	7	171	NO APICAL MERISTEM PROTEIN
1ut4_B	2e-46	23	187	7	171	NO APICAL MERISTEM PROTEIN
1ut7_A	2e-46	23	187	7	171	NO APICAL MERISTEM PROTEIN
1ut7_B	2e-46	23	187	7	171	NO APICAL MERISTEM PROTEIN
3swm_A	2e-46	23	187	10	174	NAC domain-containing protein 19
3swm_B	2e-46	23	187	10	174	NAC domain-containing protein 19
3swm_C	2e-46	23	187	10	174	NAC domain-containing protein 19
3swm_D	2e-46	23	187	10	174	NAC domain-containing protein 19
3swp_A	2e-46	23	187	10	174	NAC domain-containing protein 19
3swp_B	2e-46	23	187	10	174	NAC domain-containing protein 19
3swp_C	2e-46	23	187	10	174	NAC domain-containing protein 19
3swp_D	2e-46	23	187	10	174	NAC domain-containing protein 19
4dul_A	2e-46	23	187	7	171	NAC domain-containing protein 19
4dul_B	2e-46	23	187	7	171	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the 5'- RRYGCCGT-3' consensus core sequence. Central longevity regulator. Negative regulator of leaf senescence. Modulates cellular H(2)O(2) levels and enhances tolerance to various abiotic stresses through the regulation of DREB2A. {ECO:0000269\|PubMed:22345491}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Lus10031767

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Up-regulated by H(2)O(2), paraquat, ozone, 3-aminotriazole and salt stress. {ECO:0000269\|PubMed:22345491}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021615211.1	1e-86	transcription factor JUNGBRUNNEN 1-like
Swissprot	Q9SK55	1e-76	NAC42_ARATH; Transcription factor JUNGBRUNNEN 1
TrEMBL	A0A2C9VRP8	3e-85	A0A2C9VRP8_MANES; Uncharacterized protein
STRING	Lus10031767	1e-161	(Linum usitatissimum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1013	34	112

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G43000.1	2e-76	NAC domain containing protein 42

Link Out ? help Back to Top
Phytozome	Lus10031767

Publications ? help Back to Top
Shahnejat-Bushehri S,Nobmann B,Devi Allu A,Balazadeh S JUB1 suppresses Pseudomonas syringae-induced defense responses through accumulation of DELLA proteins. Plant Signal Behav, 2016. 11(6): p. e1181245 [PMID:27159137] Shahnejat-Bushehri S,Tarkowska D,Sakuraba Y,Balazadeh S Arabidopsis NAC transcription factor JUB1 regulates GA/BR metabolism and signalling. Nat Plants, 2016. 2: p. 16013 [PMID:27249348] Shahnejat-Bushehri S, et al. Arabidopsis NAC Transcription Factor JUNGBRUNNEN1 Exerts Conserved Control Over Gibberellin and Brassinosteroid Metabolism and Signaling Genes in Tomato. Front Plant Sci, 2017. 8: p. 214 [PMID:28326087] Sakuraba Y,Bülbül S,Piao W,Choi G,Paek NC Arabidopsis EARLY FLOWERING3 increases salt tolerance by suppressing salt stress response pathways. Plant J., 2017. 92(6): p. 1106-1120 [PMID:29032592] Ebrahimian-Motlagh S, et al. JUNGBRUNNEN1 Confers Drought Tolerance Downstream of the HD-Zip I Transcription Factor AtHB13. Front Plant Sci, 2017. 8: p. 2118 [PMID:29326734]