PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Lus10032653

Organism

Linum usitatissimum

Taxonomic ID

4006

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum

Family

NAC

Protein Properties

Length: 88aa MW: 10084.3 Da PI: 10.6509

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Lus10032653	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	62.4	1.4e-19	2	54	75	128
NAM 75 nratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 nrat +gyWka gkd+e+ + +++l +kktLvf +gr+p g++t+Wvmhe rl Lus10032653 2 NRATGKGYWKAPGKDREIRR-DNQLLAMKKTLVFLSGRSPGGQRTNWVMHEHRL 54 8****************9.999*************************997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	22.603	1	77	IPR003441	NAC domain
SuperFamily	SSF101941	9.29E-21	2	68	IPR003441	NAC domain
Pfam	PF02365	2.2E-8	2	54	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 88 aa Download sequence Send to blast
MNRATGKGYW KAPGKDREIR RDNQLLAMKK TLVFLSGRSP GGQRTNWVMH EHRLVDEELE 60 RIGTFAGENR VGRETQHHLE SQTREPS*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	2e-15	2	56	90	144	NO APICAL MERISTEM PROTEIN
1ut4_B	2e-15	2	56	90	144	NO APICAL MERISTEM PROTEIN
1ut7_A	2e-15	2	56	90	144	NO APICAL MERISTEM PROTEIN
1ut7_B	2e-15	2	56	90	144	NO APICAL MERISTEM PROTEIN
3swm_A	2e-15	2	56	93	147	NAC domain-containing protein 19
3swm_B	2e-15	2	56	93	147	NAC domain-containing protein 19
3swm_C	2e-15	2	56	93	147	NAC domain-containing protein 19
3swm_D	2e-15	2	56	93	147	NAC domain-containing protein 19
3swp_A	2e-15	2	56	93	147	NAC domain-containing protein 19
3swp_B	2e-15	2	56	93	147	NAC domain-containing protein 19
3swp_C	2e-15	2	56	93	147	NAC domain-containing protein 19
3swp_D	2e-15	2	56	93	147	NAC domain-containing protein 19
4dul_A	2e-15	2	56	90	144	NAC domain-containing protein 19
4dul_B	2e-15	2	56	90	144	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC051/NAC052 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). {ECO:0000269\|PubMed:24045019, ECO:0000269\|PubMed:25578968, ECO:0000269\|PubMed:26617990}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Lus10032653

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012081000.1	1e-31	NAC domain-containing protein 78 isoform X1
Refseq	XP_012081001.1	9e-32	NAC domain-containing protein 82 isoform X2
Refseq	XP_021688627.1	8e-32	NAC domain-containing protein 41-like isoform X2
Swissprot	Q9SQX9	2e-26	NAC50_ARATH; NAC domain containing protein 50
TrEMBL	R4NFV5	2e-30	R4NFV5_JATCU; NAC transcription factor 043
STRING	Lus10032653	1e-58	(Linum usitatissimum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G10480.1	1e-28	NAC domain containing protein 50

Link Out ? help Back to Top
Phytozome	Lus10032653

Publications ? help Back to Top
Zhang S, et al. C-terminal domains of a histone demethylase interact with a pair of transcription factors and mediate specific chromatin association. Cell Discov, 2019. [PMID:26617990]