PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Lus10037046

Organism

Linum usitatissimum

Taxonomic ID

4006

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum

Family

TCP

Protein Properties

Length: 106aa MW: 11436.2 Da PI: 11.9583

Description

TCP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Lus10037046	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	TCP	119.2	5.2e-37	23	93	3	73
TCP 3 gkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 +++++++++h kv+gR+RR+R++a+caar+F+L++eLG+++d++ti+WLl+q++p+i+++tgt++++as+ Lus10037046 23 PRRSSNKDRHKKVDGRGRRIRMPALCAARIFQLTRELGHKSDGETIQWLLNQSEPSIIAATGTGTIPASAL 93 6899****************************************************************776 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03634	1.2E-30	27	97	IPR005333	Transcription factor, TCP
PROSITE profile	PS51369	27.706	28	82	IPR017887	Transcription factor TCP subgroup

Sequence ? help Back to Top
Protein Sequence Length: 106 aa Download sequence Send to blast
MKDVQITALV PTSSTKKQQS LGPRRSSNKD RHKKVDGRGR RIRMPALCAA RIFQLTRELG 60 HKSDGETIQW LLNQSEPSII AATGTGTIPA SALAAARSSG WISRI*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds to the site II motif (3'-TGGGCC/T-5') in the promoter of PCNA-2 and to 3'-GCCCG/A-5' elements in the promoters of cyclin CYCB1-1 and ribosomal protein genes. {ECO:0000269\|PubMed:12631321, ECO:0000269\|PubMed:16123132}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Lus10037046

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	NP_001304347.2	1e-48	transcription factor TCP20-like
Refseq	XP_028218369.1	1e-48	transcription factor TCP20-like
Swissprot	Q9LSD5	1e-42	TCP20_ARATH; Transcription factor TCP20
TrEMBL	A0A445FED1	2e-47	A0A445FED1_GLYSO; Transcription factor TCP20
TrEMBL	C6TGU9	2e-47	C6TGU9_SOYBN; Uncharacterized protein
TrEMBL	I1N7U7	2e-47	I1N7U7_SOYBN; Uncharacterized protein
STRING	Lus10037046	1e-70	(Linum usitatissimum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF3339	32	69

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G27010.1	4e-45	TCP family protein

Link Out ? help Back to Top
Phytozome	Lus10037046

Publications ? help Back to Top
Zhu P, et al. Arabidopsis small nucleolar RNA monitors the efficient pre-rRNA processing during ribosome biogenesis. Proc. Natl. Acad. Sci. U.S.A., 2016. 113(42): p. 11967-11972 [PMID:27708161] Wu JF, et al. LWD-TCP complex activates the morning gene CCA1 in Arabidopsis. Nat Commun, 2016. 7: p. 13181 [PMID:27734958] Guan P, et al. Interacting TCP and NLP transcription factors control plant responses to nitrate availability. Proc. Natl. Acad. Sci. U.S.A., 2017. 114(9): p. 2419-2424 [PMID:28202720] Guan P Dancing with Hormones: A Current Perspective of Nitrate Signaling and Regulation in Arabidopsis. Front Plant Sci, 2017. 8: p. 1697 [PMID:29033968] Zhang N, et al. MOS1 functions closely with TCP transcription factors to modulate immunity and cell cycle in Arabidopsis. Plant J., 2018. 93(1): p. 66-78 [PMID:29086441] Bresso EG,Chorostecki U,Rodriguez RE,Palatnik JF,Schommer C Spatial Control of Gene Expression by miR319-Regulated TCP Transcription Factors in Leaf Development. Plant Physiol., 2018. 176(2): p. 1694-1708 [PMID:29133375] Konishi N,Okubo T,Yamaya T,Hayakawa T,Minamisawa K Nitrate Supply-Dependent Shifts in Communities of Root-Associated Bacteria in Arabidopsis. Microbes Environ., 2017. 32(4): p. 314-323 [PMID:29187692]