PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Lus10042114

Organism

Linum usitatissimum

Taxonomic ID

4006

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum

Family

Dof

Protein Properties

Length: 113aa MW: 12529.4 Da PI: 8.2742

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Lus10042114	genome	BGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	117.6	4.9e-37	60	112	2	54
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGgg 54 +++alkcprC+st+tkfCyynnysl+qPryfCk+CrryWtkGG+lrn+PvGgg Lus10042114 60 QDQALKCPRCESTHTKFCYYNNYSLTQPRYFCKTCRRYWTKGGTLRNIPVGGG 112 6899***********************************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	2.0E-27	54	112	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	1.2E-31	61	112	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	27.428	64	112	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	66	102	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0010067	Biological Process	procambium histogenesis
GO:0010087	Biological Process	phloem or xylem histogenesis
GO:0045893	Biological Process	positive regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 113 aa Download sequence Send to blast
MGLTSLQVCM DSPADWLLQG TMAEDVESGL LDPSNGGDML LAACSRQPAA MMERRLRPPQ 60 DQALKCPRCE STHTKFCYYN NYSLTQPRYF CKTCRRYWTK GGTLRNIPVG GG*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence (By similarity). Promotes expression (PubMed:19915089). The PEAR proteins (e.g. DOF2.4, DOF5.1, DOF3.2, DOF1.1, DOF5.6 and DOF5.3) activate gene expression that promotes radial growth of protophloem sieve elements (PubMed:30626969). Involved in the regulation of interfascicular cambium formation and vascular tissue development, particularly at a very early stage during inflorescence stem development; promotes both cambium activity and phloem specification, but prevents xylem specification (PubMed:19915089). {ECO:0000250\|UniProtKB:Q9M2U1, ECO:0000269\|PubMed:19915089, ECO:0000269\|PubMed:30626969}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00580	DAP	Transfer from AT5G62940	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Lus10042114

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015882520.1	3e-51	dof zinc finger protein DOF5.6
Swissprot	Q9FM03	8e-44	DOF56_ARATH; Dof zinc finger protein DOF5.6
TrEMBL	A0A1R3JBB5	8e-50	A0A1R3JBB5_COCAP; Zinc finger, Dof-type
STRING	Lus10042114	2e-79	(Linum usitatissimum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF5092	34	56

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G62940.1	3e-46	Dof family protein

Link Out ? help Back to Top
Phytozome	Lus10042114

Publications ? help Back to Top
Miyashima S, et al. Mobile PEAR transcription factors integrate positional cues to prime cambial growth. Nature, 2019. 565(7740): p. 490-494 [PMID:30626969]