![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Lus10042810 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 78aa MW: 8549.61 Da PI: 4.8432 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 43.2 | 8.6e-14 | 1 | 41 | 10 | 50 |
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50
++kNRe+A rsR+RK+a++ eLe + +Le+e ++L ke
Lus10042810 1 MIKNRESAARSRERKQAYQVELESLAVKLEEEHEQLLKEKF 41
68**********************************99855 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF00170 | 2.2E-11 | 1 | 39 | IPR004827 | Basic-leucine zipper domain |
| Gene3D | G3DSA:1.20.5.170 | 4.5E-12 | 1 | 43 | No hit | No description |
| SuperFamily | SSF57959 | 2.88E-9 | 1 | 44 | No hit | No description |
| PROSITE profile | PS50217 | 8.829 | 1 | 39 | IPR004827 | Basic-leucine zipper domain |
| SMART | SM00338 | 0.0074 | 1 | 60 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 78 aa Download sequence Send to blast |
MIKNRESAAR SRERKQAYQV ELESLAVKLE EEHEQLLKEK FLLNHAAYGE SDSCGGEAKT 60 GTNAAQSLLL GVVDDIM* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Binds to the G-box motif (5'-CCACGTGG-3') of the rbcS-1A gene promoter. G-box and G-box-like motifs are cis-acting elements defined in promoters of certain plant genes which are regulated by such diverse stimuli as light-induction or hormone control. {ECO:0000269|PubMed:8146148}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Lus10042810 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021284665.1 | 1e-16 | G-box-binding factor 4 | ||||
| Refseq | XP_024458000.1 | 1e-16 | G-box-binding factor 4 isoform X1 | ||||
| Refseq | XP_024458002.1 | 8e-17 | G-box-binding factor 4 isoform X4 | ||||
| Swissprot | P42777 | 1e-15 | GBF4_ARATH; G-box-binding factor 4 | ||||
| TrEMBL | B9SE72 | 5e-16 | B9SE72_RICCO; Transcription factor, putative | ||||
| STRING | Lus10042810 | 8e-49 | (Linum usitatissimum) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2028 | 34 | 81 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G03970.1 | 4e-11 | G-box binding factor 4 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Lus10042810 |




