![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MA_10429262g0010 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 218aa MW: 23623.6 Da PI: 6.6161 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 145.6 | 1.4e-45 | 9 | 108 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkae 93
+CaaCk+lrrkC+++Cv+apyfp e+p+kfanvhk+FGasnv+k+l++l++++reda++sl+yeAear++dPvyG+vg i+ lq+q++ql++e
MA_10429262g0010 9 PCAACKFLRRKCTSECVFAPYFPPEEPQKFANVHKIFGASNVTKILNDLEPHQREDAVNSLAYEAEARLKDPVYGCVGAISILQRQVQQLQKE 101
7******************************************************************************************** PP
DUF260 94 lallkee 100
la++++
MA_10429262g0010 102 LAAAHAD 108
**99875 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 27.928 | 8 | 109 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 1.1E-44 | 9 | 106 | IPR004883 | Lateral organ boundaries, LOB |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0010199 | Biological Process | organ boundary specification between lateral organs and the meristem | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 218 aa Download sequence Send to blast |
MASTSSNSPC AACKFLRRKC TSECVFAPYF PPEEPQKFAN VHKIFGASNV TKILNDLEPH 60 QREDAVNSLA YEAEARLKDP VYGCVGAISI LQRQVQQLQK ELAAAHADLL QYTSAAEPVL 120 NPHSPGSTLP TYSRFQMIHS AATEQQQQNL VEFPNSRELQ LTREQLLELA LRIGGSYEAG 180 LAALGMTNHA YALYPSPRPA SDGGSGSSGC SFGHLSSP |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 2e-62 | 3 | 112 | 5 | 114 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 2e-62 | 3 | 112 | 5 | 114 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00581 | DAP | Transfer from AT5G63090 | Download |
| |||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | FJ104457 | 1e-148 | FJ104457.2 Pinus taeda isolate 2080 anonymous locus 2_8995_01 genomic sequence. | |||
| GenBank | FJ104458 | 1e-148 | FJ104458.2 Pinus taeda isolate 2084 anonymous locus 2_8995_01 genomic sequence. | |||
| GenBank | FJ104459 | 1e-148 | FJ104459.1 Pinus taeda isolate 2082 anonymous locus 2_8995_01 genomic sequence. | |||
| GenBank | FJ104460 | 1e-148 | FJ104460.2 Pinus taeda isolate 2090 anonymous locus 2_8995_01 genomic sequence. | |||
| GenBank | FJ104461 | 1e-148 | FJ104461.2 Pinus taeda isolate 2094 anonymous locus 2_8995_01 genomic sequence. | |||
| GenBank | FJ104462 | 1e-148 | FJ104462.2 Pinus taeda isolate 2085 anonymous locus 2_8995_01 genomic sequence. | |||
| GenBank | FJ104463 | 1e-148 | FJ104463.1 Pinus taeda isolate 2087 anonymous locus 2_8995_01 genomic sequence. | |||
| GenBank | FJ104464 | 1e-148 | FJ104464.2 Pinus taeda isolate 2093 anonymous locus 2_8995_01 genomic sequence. | |||
| GenBank | FJ104465 | 1e-148 | FJ104465.2 Pinus taeda isolate 2088 anonymous locus 2_8995_01 genomic sequence. | |||
| GenBank | FJ104466 | 1e-148 | FJ104466.2 Pinus taeda isolate 2081 anonymous locus 2_8995_01 genomic sequence. | |||
| GenBank | FJ104467 | 1e-148 | FJ104467.2 Pinus taeda isolate 2092 anonymous locus 2_8995_01 genomic sequence. | |||
| GenBank | FJ104468 | 1e-148 | FJ104468.2 Pinus taeda isolate 2086 anonymous locus 2_8995_01 genomic sequence. | |||
| GenBank | FJ104469 | 1e-148 | FJ104469.1 Pinus taeda isolate 2095 anonymous locus 2_8995_01 genomic sequence. | |||
| GenBank | FJ104470 | 1e-148 | FJ104470.1 Pinus taeda isolate 2091 anonymous locus 2_8995_01 genomic sequence. | |||
| GenBank | FJ104471 | 1e-148 | FJ104471.1 Pinus taeda isolate 2089 anonymous locus 2_8995_01 genomic sequence. | |||
| GenBank | FJ104472 | 1e-148 | FJ104472.2 Pinus taeda isolate 2096 anonymous locus 2_8995_01 genomic sequence. | |||
| GenBank | FJ104473 | 1e-148 | FJ104473.2 Pinus taeda isolate 2083 anonymous locus 2_8995_01 genomic sequence. | |||
| GenBank | FJ104474 | 1e-148 | FJ104474.2 Pinus taeda isolate 2079 anonymous locus 2_8995_01 genomic sequence. | |||
| GenBank | JQ262918 | 1e-148 | JQ262918.1 Pinus radiata isolate 2097 hypothetical protein (2_8995_01) gene, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024403438.1 | 7e-69 | LOB domain-containing protein 6-like | ||||
| Swissprot | Q8L8Q3 | 3e-63 | LBD25_ARATH; LOB domain-containing protein 25 | ||||
| TrEMBL | H9X0F3 | 6e-82 | H9X0F3_PINTA; Uncharacterized protein (Fragment) | ||||
| STRING | PP1S170_78V6.1 | 3e-68 | (Physcomitrella patens) | ||||
| STRING | PP1S170_93V6.1 | 6e-68 | (Physcomitrella patens) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP60 | 16 | 318 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G27650.1 | 1e-65 | LOB domain-containing protein 25 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




