![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MA_10435988g0010 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 106aa MW: 12263 Da PI: 11.404 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 49.1 | 1.3e-15 | 13 | 57 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
+WT+eE+ l++ + +++G+g+W++I+r + Rt+ q+ s+ qky
MA_10435988g0010 13 PWTEEEHRLFLMGLAKHGKGDWRSISRNFVVSRTPTQVASHAQKY 57
7*******************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 19.229 | 5 | 62 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 1.1E-17 | 8 | 62 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 1.4E-11 | 10 | 60 | IPR001005 | SANT/Myb domain |
| TIGRFAMs | TIGR01557 | 2.7E-17 | 10 | 60 | IPR006447 | Myb domain, plants |
| Gene3D | G3DSA:1.10.10.60 | 4.4E-13 | 11 | 57 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 3.1E-13 | 13 | 57 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.70E-10 | 13 | 58 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 106 aa Download sequence Send to blast |
MECTKQERRK GIPWTEEEHR LFLMGLAKHG KGDWRSISRN FVVSRTPTQV ASHAQKYFLR 60 LSSGNKXXXX AQKYFLRLSS GNKEKERSNI RDIISPNPGA VSRSRL |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepresses strongly the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. Functions with GAMYB to integrate diverse nutrient starvation and gibberellin (GA) signaling pathways during germination of grains. Sugar, nitrogen and phosphate starvation signals converge and interconnect with GA to promote the co-nuclear import of MYBS1 and GAMYB, resulting in the expression of a large set of GA-inducible hydrolases, transporters, and regulators that are essential for mobilization of nutrient reserves in the endosperm to support seedling growth (PubMed:22773748). {ECO:0000269|PubMed:12172034, ECO:0000269|PubMed:22773748}. | |||||
| UniProt | Transcription activator that binds to 5'-TATCCA-3' elements in gene promoters. Derepress strongly the sugar-repressed transcription of promoters containing SRS or 5'-TATCCA-3' elements. {ECO:0000250|UniProtKB:Q8LH59}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by sucrose and gibberellic acid (GA). {ECO:0000269|PubMed:12172034}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | BT113302 | 5e-98 | BT113302.1 Picea glauca clone GQ03404_E15 mRNA sequence. | |||
| GenBank | EF081893 | 5e-98 | EF081893.1 Picea sitchensis clone WS0277_M02 unknown mRNA. | |||
| GenBank | EF084448 | 5e-98 | EF084448.1 Picea sitchensis clone WS02910_I01 unknown mRNA. | |||
| GenBank | EF678099 | 5e-98 | EF678099.1 Picea sitchensis clone WS02822_H23 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_003062320.1 | 2e-35 | predicted protein | ||||
| Swissprot | B8A9B2 | 2e-33 | MYBS1_ORYSI; Transcription factor MYBS1 | ||||
| Swissprot | Q8LH59 | 2e-33 | MYBS1_ORYSJ; Transcription factor MYBS1 | ||||
| TrEMBL | A9NKW2 | 5e-51 | A9NKW2_PICSI; Uncharacterized protein | ||||
| TrEMBL | A9NT05 | 5e-51 | A9NT05_PICSI; Uncharacterized protein | ||||
| STRING | XP_003062320.1 | 8e-35 | (Micromonas pusilla) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP394 | 16 | 99 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G49010.1 | 3e-35 | MYB family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




