PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MA_12314g0010

Organism

Picea abies

Taxonomic ID

3329

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea

Family

ZF-HD

Protein Properties

Length: 89aa MW: 9720.77 Da PI: 6.9908

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MA_12314g0010	genome	ConGenIE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	106.3	1.8e-33	22	79	2	60
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 ++vrY eC+kNhAas+Gg+avDGCgEfm+s geegtaaalkCaAC+CHR+FHRre e+e MA_12314g0010 22 KGVRYGECQKNHAASIGGYAVDGCGEFMAS-GEEGTAAALKCAACNCHRSFHRREIENE 79 579************************9.999*******************9876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	6.0E-24	22	89	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	3.1E-31	24	76	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	4.4E-29	25	76	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	26.751	26	75	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 89 aa Download sequence Send to blast
MRPSEMQHTE DSRRGVDASL RKGVRYGECQ KNHAASIGGY AVDGCGEFMA SGEEGTAAAL 60 KCAACNCHRS FHRREIENET LCECHRTGS

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	BT101040	1e-144	BT101040.1 Picea glauca clone GQ0065_E22 mRNA sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_022740047.1	2e-33	mini zinc finger protein 2-like
Swissprot	Q9LJW5	5e-31	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	A9NYD8	4e-40	A9NYD8_PICSI; Uncharacterized protein
STRING	EOY03457	2e-31	(Theobroma cacao)
STRING	XP_010258353.1	2e-31	(Nelumbo nucifera)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP91	16	237

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	2e-33	mini zinc finger 2

Publications ? help Back to Top
Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]