![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MA_168035g0010 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 161aa MW: 17961.2 Da PI: 5.7398 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 183.7 | 1.4e-57 | 24 | 121 | 1 | 98 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
vreqdrflPian+srimkk+lPan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa++tlGfedy+eplkvyl yre+eg
MA_168035g0010 24 VREQDRFLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMSTLGFEDYIEPLKVYLLMYREAEG 118
69********************************************************************************************* PP
NF-YB 96 ekk 98
++k
MA_168035g0010 119 DNK 121
975 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 4.6E-56 | 18 | 147 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 6.74E-41 | 27 | 141 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.7E-28 | 30 | 94 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 3.4E-20 | 58 | 76 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 61 | 77 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 3.4E-20 | 77 | 95 | No hit | No description |
| PRINTS | PR00615 | 3.4E-20 | 96 | 114 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 161 aa Download sequence Send to blast |
MAEASSPGSQ ESPRSGEQSP QSSVREQDRF LPIANISRIM KKALPANGKI AKDAKETVQE 60 CVSEFISFIT SEASDKCQRE KRKTINGDDL LWAMSTLGFE DYIEPLKVYL LMYREAEGDN 120 KGSSKSGVDQ YGKKESNVHQ GIPNMQSQMQ HHMVTMQGND L |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1n1j_A | 4e-48 | 23 | 115 | 1 | 93 | NF-YB |
| 4awl_B | 5e-48 | 23 | 115 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 5e-48 | 23 | 115 | 2 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EF087832 | 0.0 | EF087832.1 Picea sitchensis clone WS02817_N19 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_011622921.1 | 3e-79 | nuclear transcription factor Y subunit B-1 | ||||
| Refseq | XP_011622922.1 | 3e-79 | nuclear transcription factor Y subunit B-1 | ||||
| Refseq | XP_011622923.1 | 3e-79 | nuclear transcription factor Y subunit B-1 | ||||
| Refseq | XP_020522171.1 | 3e-79 | nuclear transcription factor Y subunit B-1 | ||||
| Swissprot | Q8VYK4 | 2e-72 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | A9P2F4 | 1e-117 | A9P2F4_PICSI; Uncharacterized protein | ||||
| STRING | XP_008442637.1 | 3e-78 | (Cucumis melo) | ||||
| STRING | XP_004137802.1 | 3e-78 | (Cucumis sativus) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP168 | 17 | 170 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G37060.3 | 7e-75 | nuclear factor Y, subunit B8 | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




