![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MA_28402g0010 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 111aa MW: 12875.3 Da PI: 9.2873 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 46.6 | 7.3e-15 | 67 | 110 | 5 | 48 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48
+r++r++kNRe+A rsR+R++a++ eLe +v +L +eN +L+ke
MA_28402g0010 67 RRQKRMIKNRESAARSRARRQAYTNELEIEVNKLIEENARLRKE 110
79****************************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.20.5.170 | 2.0E-14 | 58 | 110 | No hit | No description |
| SMART | SM00338 | 1.9E-5 | 63 | 110 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 11.243 | 65 | 111 | IPR004827 | Basic-leucine zipper domain |
| Pfam | PF00170 | 2.8E-12 | 67 | 110 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 5.5E-10 | 67 | 110 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 70 | 85 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 111 aa Download sequence Send to blast |
MDSVLAGQNL QHPEWLQFHN QHQQFGELSA QANSNNDIPL MAASSGSEHP VWKKRGCESI 60 ADHTVERRQK RMIKNRESAA RSRARRQAYT NELEIEVNKL IEENARLRKE Q |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter and to the ABRE of the Em1 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EF676814 | 0.0 | EF676814.1 Picea sitchensis clone WS02753_G19 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_010517591.1 | 2e-23 | PREDICTED: ABSCISIC ACID-INSENSITIVE 5-like protein 3 | ||||
| Swissprot | Q9C5Q2 | 5e-23 | AI5L3_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 3 | ||||
| TrEMBL | B8LM16 | 8e-75 | B8LM16_PICSI; Uncharacterized protein | ||||
| STRING | Bostr.9345s0024.1.p | 7e-23 | (Boechera stricta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP10063 | 7 | 11 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G41070.3 | 3e-17 | bZIP family protein | ||||
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




