PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MA_308669g0010

Organism

Picea abies

Taxonomic ID

3329

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea

Family

MYB

Protein Properties

Length: 192aa MW: 21942.8 Da PI: 8.5768

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MA_308669g0010	genome	ConGenIE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	41	4.6e-13	14	59	1	46
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 +g+WT+eEd +l+ ++ +G g+W++ +r g+ R++k+c+ r + MA_308669g0010 14 KGAWTPEEDARLIAHIRAHGEGCWRSLPRAAGLLRCGKSCRIRRIN 59 79****************************99*****87665 PP
2	Myb_DNA-binding	57.7	2.7e-18	67	111	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg++++eEde ++++ lG++ W++Iar+++ gRt++++k++w++y MA_308669g0010 67 RGNFSEEEDEFIIKLYSTLGNK-WSLIARRLP-GRTDNEIKNYWNTY 111 89******************.*****.**********99 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	8.6E-19	5	65	IPR009057	Homeodomain-like
PROSITE profile	PS51294	11.737	9	58	IPR017930	Myb domain
SuperFamily	SSF46689	4.23E-25	13	108	IPR009057	Homeodomain-like
SMART	SM00717	4.0E-8	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	1.7E-10	14	59	IPR001005	SANT/Myb domain
PROSITE profile	PS51294	27.652	62	116	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	4.7E-26	66	116	IPR009057	Homeodomain-like
SMART	SM00717	1.9E-17	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	1.5E-16	67	111	IPR001005	SANT/Myb domain
CDD	cd00167	3.23E-13	69	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 192 aa Download sequence Send to blast
MGRSPCCEKA HTNKGAWTPE EDARLIAHIR AHGEGCWRSL PRAAGLLRCG KSCRIRRINY 60 PRPDVKRGNF SEEEDEFIIK LYSTLGNKWS LIARRLPGRT DNEIKNYWNT YIKKKLLKRG 120 LDHQFDSPLC SPHNSNTTRS SRPAPEHQIP AFQSPRTPEI ADFFQYDLSG CSPIEPAASK 180 DEEHPDINLD LC

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	1e-25	13	116	26	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. {ECO:0000305}.
UniProt	Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269\|PubMed:11080161}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269\|PubMed:11080161}.

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	FJ469923	0.0	FJ469923.1 Picea glauca R2R3-MYB transcription factor MYB17 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010028718.1	6e-81	PREDICTED: myb-related protein 308
Swissprot	P81393	1e-73	MYB08_ANTMA; Myb-related protein 308
Swissprot	Q9SZP1	2e-73	MYB4_ARATH; Transcription repressor MYB4
TrEMBL	C0JTD6	1e-128	C0JTD6_PICGL; R2R3-MYB transcription factor MYB17
STRING	XP_010028718.1	2e-80	(Eucalyptus grandis)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP5	17	1784

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G38620.1	7e-76	myb domain protein 4

Publications ? help Back to Top
Jackson D,Culianez-Macia F,Prescott AG,Roberts K,Martin C Expression patterns of myb genes from Antirrhinum flowers. Plant Cell, 1991. 3(2): p. 115-25 [PMID:1840903] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Zhang J, et al. Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]