| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | SRF-TF | 84.5 | 6.2e-27 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien + rq tfskRr+g+lKKA+ELS+LCdae+avi+fss+gk++ y+s
MA_6805g0010 9 KRIENPTSRQATFSKRRAGLLKKAKELSILCDAEIAVIVFSSSGKVFQYAS 59
79***********************************************86 PP
|
| 2 | K-box | 71.3 | 2.9e-24 | 85 | 174 | 10 | 99 |
K-box 10 eeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99
e ++ + +lakLk + e++q +Rh++GedLe L+ +eLqq+e+++e ++ ++R+kKn+ +l+ i+e + e++l+eenk+Lr+++e
MA_6805g0010 85 VEYSDNNENIQLAKLKLQAEQMQLVLRHMMGEDLEGLDTEELQQMEEKMELGMGRVRAKKNQCMLNRIKEITNTERDLREENKSLRRRVE 174
444456677789***************************************************************************987 PP
|
| Protein Features
? help Back to Top |
 |
| Database |
Entry ID |
E-value |
Start |
End |
InterPro ID |
Description |
| SMART | SM00432 | 8.4E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 31.847 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 8.37E-32 | 2 | 82 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.37E-43 | 2 | 74 | No hit | No description |
| PRINTS | PR00404 | 5.8E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.1E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.8E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 5.8E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS51297 | 14.05 | 89 | 179 | IPR002487 | Transcription factor, K-box |
| Pfam | PF01486 | 2.1E-19 | 93 | 173 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0001708 | Biological Process | cell fate specification |
| GO:0009553 | Biological Process | embryo sac development |
| GO:0009933 | Biological Process | meristem structural organization |
| GO:0010076 | Biological Process | maintenance of floral meristem identity |
| GO:0010094 | Biological Process | specification of carpel identity |
| GO:0010582 | Biological Process | floral meristem determinacy |
| GO:0045893 | Biological Process | positive regulation of transcription, DNA-templated |
| GO:0048455 | Biological Process | stamen formation |
| GO:0048459 | Biological Process | floral whorl structural organization |
| GO:0048509 | Biological Process | regulation of meristem development |
| GO:0048833 | Biological Process | specification of floral organ number |
| GO:0080060 | Biological Process | integument development |
| GO:0080112 | Biological Process | seed growth |
| GO:0005634 | Cellular Component | nucleus |
| GO:0003677 | Molecular Function | DNA binding |
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
| GO:0046982 | Molecular Function | protein heterodimerization activity |