PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MA_709537g0010

Organism

Picea abies

Taxonomic ID

3329

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea

Family

Whirly

Protein Properties

Length: 107aa MW: 11912.8 Da PI: 7.9203

Description

Whirly family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MA_709537g0010	genome	ConGenIE	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Whirly	125.4	3.2e-39	1	100	11	110
Whirly 11 vkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlpdGsGl 105 +++++p+++++dsg ++l+++G ++le+a+a++ r+ydW+kkq fals+ e+++l++l ++e+ceffhdp+ ++s++Gk+rk+lkv l d G+ MA_709537g0010 1 MQPKAPEYSTVDSGGIRLSKEGCVFLEFAPAVGIRQYDWSKKQIFALSVLELGTLLSLDPNEPCEFFHDPFVGKSEAGKIRKVLKVGMLQDTGGY 95 6899***************************************************************************************** PP Whirly 106 fvnls 110 f+nl MA_709537g0010 96 FFNLR 100 *97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.30.31.10	1.2E-38	1	100	IPR009044	ssDNA-binding transcriptional regulator
SuperFamily	SSF54447	2.04E-32	1	100	IPR009044	ssDNA-binding transcriptional regulator
Pfam	PF08536	1.0E-38	1	100	IPR013742	Plant transcription factor

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 107 aa Download sequence Send to blast
MQPKAPEYST VDSGGIRLSK EGCVFLEFAP AVGIRQYDWS KKQIFALSVL ELGTLLSLDP 60 NEPCEFFHDP FVGKSEAGKI RKVLKVGMLQ DTGGYFFNLR KFCSCLA

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4koo_A	6e-43	1	99	24	122	Single-stranded DNA-binding protein WHY1, chloroplastic
4koo_B	6e-43	1	99	24	122	Single-stranded DNA-binding protein WHY1, chloroplastic
4koo_C	6e-43	1	99	24	122	Single-stranded DNA-binding protein WHY1, chloroplastic
4koo_D	6e-43	1	99	24	122	Single-stranded DNA-binding protein WHY1, chloroplastic
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Single-stranded DNA-binding protein that functions in both chloroplasts and nucleus. In chloroplasts, maintains plastid genome stability by preventing break-induced and short homology-dependent illegitimate recombinations. In nucleus, modulates telomere length homeostasis by inhibiting the action of the telomerase at the extreme termini of chromosomes. Is recruited to a distal element upstream of the kinesin KP1 to mediate the transcriptional repression of KP1. Is required for full salicylic acid-dependent plant disease resistance responses. Can bind double-stranded DNA in vivo. {ECO:0000269\|PubMed:14960277, ECO:0000269\|PubMed:17217467, ECO:0000269\|PubMed:19666500, ECO:0000269\|PubMed:19669906, ECO:0000269\|PubMed:20551348, ECO:0000269\|PubMed:21911368}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By salicylic acid (SA) and infection by H.parasitica. {ECO:0000269\|PubMed:14960277, ECO:0000269\|PubMed:19669906}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010527874.1	1e-41	PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic-like
Refseq	XP_020869165.1	8e-42	single-stranded DNA-binding protein WHY1, chloroplastic
Swissprot	Q9M9S3	5e-42	WHY1_ARATH; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBL	A9NLD1	1e-47	A9NLD1_PICSI; Uncharacterized protein
TrEMBL	A9NQE8	2e-47	A9NQE8_PICSI; Uncharacterized protein
STRING	evm.model.supercontig_1007.4	4e-41	(Carica papaya)
STRING	fgenesh2_kg.1__1569__AT1G14410.1	3e-41	(Arabidopsis lyrata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Representative plant	OGRP2316	16	35

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G14410.1	5e-36	ssDNA-binding transcriptional regulator

Publications ? help Back to Top
Lepage É,Zampini É,Brisson N Plastid genome instability leads to reactive oxygen species production and plastid-to-nucleus retrograde signaling in Arabidopsis. Plant Physiol., 2013. 163(2): p. 867-81 [PMID:23969600] Carella P,Wilson DC,Cameron RK Some things get better with age: differences in salicylic acid accumulation and defense signaling in young and mature Arabidopsis. Front Plant Sci, 2014. 5: p. 775 [PMID:25620972] Zampini É,Lepage É,Tremblay-Belzile S,Truche S,Brisson N Organelle DNA rearrangement mapping reveals U-turn-like inversions as a major source of genomic instability in Arabidopsis and humans. Genome Res., 2015. 25(5): p. 645-54 [PMID:25800675] Ren Y,Li Y,Jiang Y,Wu B,Miao Y Phosphorylation of WHIRLY1 by CIPK14 Shifts Its Localization and Dual Functions in Arabidopsis. Mol Plant, 2017. 10(5): p. 749-763 [PMID:28412544] Karpinska B,Alomrani SO,Foyer CH Inhibitor-induced oxidation of the nucleus and cytosol in Arabidopsis thaliana: implications for organelle to nucleus retrograde signalling. Philos. Trans. R. Soc. Lond., B, Biol. Sci., 2018. [PMID:28808105] Huang D,Lin W,Deng B,Ren Y,Miao Y Dual-Located WHIRLY1 Interacting with LHCA1 Alters Photochemical Activities of Photosystem I and Is Involved in Light Adaptation in Arabidopsis. Int J Mol Sci, 2018. [PMID:29112140] Guan Z,Wang W,Yu X,Lin W,Miao Y Comparative Proteomic Analysis of Coregulation of CIPK14 and WHIRLY1/3 Mediated Pale Yellowing of Leaves in Arabidopsis. Int J Mol Sci, 2018. [PMID:30065159]