PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_89233g0010
Organism
Picea abies
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family Whirly
Protein Properties Length: 172aa    MW: 19084 Da    PI: 5.2472
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_89233g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly149.51.2e-46112911139
         Whirly  11 vkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpaakgsneGkvrkalkvePlpdGsGlf 106
                    +k+++p++ +l+ g +++ ++G ++le+a+a+++r+ydW+kk+  als+ ev++l++l++ escef hdp++++s++Gk+ k+lkv  l d  G+f
  MA_89233g0010   1 MKPKLPDYITLNMGGVTVAKEGCMFLEFAPAVGPRQYDWSKKKIIALSVVEVGTLLSLGPDESCEFTHDPFMGKSEAGKIMKVLKVGNLQDTGGYF 96 
                    7999******************************************************************************************** PP

         Whirly 107 vnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                    +nlsvt  +  ++esfs+P++k+ef+v++s+++
  MA_89233g0010  97 FNLSVTDRIADVDESFSIPITKGEFSVMQSIFN 129
                    ******************************996 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF085362.3E-471127IPR013742Plant transcription factor
SuperFamilySSF544473.37E-521168IPR009044ssDNA-binding transcriptional regulator
Gene3DG3DSA:2.30.31.109.9E-641151IPR009044ssDNA-binding transcriptional regulator
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0032211Biological Processnegative regulation of telomere maintenance via telomerase
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0045910Biological Processnegative regulation of DNA recombination
GO:0009508Cellular Componentplastid chromosome
GO:0009570Cellular Componentchloroplast stroma
GO:0003697Molecular Functionsingle-stranded DNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0003723Molecular FunctionRNA binding
GO:0042162Molecular Functiontelomeric DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 172 aa     Download sequence    Send to blast
MKPKLPDYIT LNMGGVTVAK EGCMFLEFAP AVGPRQYDWS KKKIIALSVV EVGTLLSLGP  60
DESCEFTHDP FMGKSEAGKI MKVLKVGNLQ DTGGYFFNLS VTDRIADVDE SFSIPITKGE  120
FSVMQSIFNF ILPYLMGWHA YMDSTKLNES GHFKSGGPSI AKRPDLEWDV PF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4koo_A5e-61114624169Single-stranded DNA-binding protein WHY1, chloroplastic
4koo_B5e-61114624169Single-stranded DNA-binding protein WHY1, chloroplastic
4koo_C5e-61114624169Single-stranded DNA-binding protein WHY1, chloroplastic
4koo_D5e-61114624169Single-stranded DNA-binding protein WHY1, chloroplastic
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtSingle-stranded DNA-binding protein that functions in both chloroplasts and nucleus. In chloroplasts, maintains plastid genome stability by preventing break-induced and short homology-dependent illegitimate recombinations. In nucleus, modulates telomere length homeostasis by inhibiting the action of the telomerase at the extreme termini of chromosomes. Is recruited to a distal element upstream of the kinesin KP1 to mediate the transcriptional repression of KP1. Is required for full salicylic acid-dependent plant disease resistance responses. Can bind double-stranded DNA in vivo. {ECO:0000269|PubMed:14960277, ECO:0000269|PubMed:17217467, ECO:0000269|PubMed:19666500, ECO:0000269|PubMed:19669906, ECO:0000269|PubMed:20551348, ECO:0000269|PubMed:21911368}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salicylic acid (SA) and infection by H.parasitica. {ECO:0000269|PubMed:14960277, ECO:0000269|PubMed:19669906}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0835150.0EF083515.1 Picea sitchensis clone WS02721_C09 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010256524.14e-63PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic-like
SwissprotQ9M9S32e-62WHY1_ARATH; Single-stranded DNA-binding protein WHY1, chloroplastic
TrEMBLA9NQE81e-124A9NQE8_PICSI; Uncharacterized protein
STRINGXP_010256524.12e-62(Nelumbo nucifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP23161635
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14410.17e-65ssDNA-binding transcriptional regulator
Publications ? help Back to Top
  1. Lepage É,Zampini É,Brisson N
    Plastid genome instability leads to reactive oxygen species production and plastid-to-nucleus retrograde signaling in Arabidopsis.
    Plant Physiol., 2013. 163(2): p. 867-81
    [PMID:23969600]
  2. Carella P,Wilson DC,Cameron RK
    Some things get better with age: differences in salicylic acid accumulation and defense signaling in young and mature Arabidopsis.
    Front Plant Sci, 2014. 5: p. 775
    [PMID:25620972]
  3. Zampini É,Lepage É,Tremblay-Belzile S,Truche S,Brisson N
    Organelle DNA rearrangement mapping reveals U-turn-like inversions as a major source of genomic instability in Arabidopsis and humans.
    Genome Res., 2015. 25(5): p. 645-54
    [PMID:25800675]
  4. Ren Y,Li Y,Jiang Y,Wu B,Miao Y
    Phosphorylation of WHIRLY1 by CIPK14 Shifts Its Localization and Dual Functions in Arabidopsis.
    Mol Plant, 2017. 10(5): p. 749-763
    [PMID:28412544]
  5. Karpinska B,Alomrani SO,Foyer CH
    Inhibitor-induced oxidation of the nucleus and cytosol in Arabidopsis thaliana: implications for organelle to nucleus retrograde signalling.
    Philos. Trans. R. Soc. Lond., B, Biol. Sci., 2018.
    [PMID:28808105]
  6. Huang D,Lin W,Deng B,Ren Y,Miao Y
    Dual-Located WHIRLY1 Interacting with LHCA1 Alters Photochemical Activities of Photosystem I and Is Involved in Light Adaptation in Arabidopsis.
    Int J Mol Sci, 2018.
    [PMID:29112140]
  7. Guan Z,Wang W,Yu X,Lin W,Miao Y
    Comparative Proteomic Analysis of Coregulation of CIPK14 and WHIRLY1/3 Mediated Pale Yellowing of Leaves in Arabidopsis.
    Int J Mol Sci, 2018.
    [PMID:30065159]