PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MDP0000031172

Organism

Malus domestica

Taxonomic ID

3750

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus

Family

MYB

Protein Properties

Length: 175aa MW: 19590.6 Da PI: 11.0012

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MDP0000031172	genome	GDR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	50.2	5.8e-16	14	61	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+WT+ Ed++l ++k +G g W++ +++ g++R++k+c++rw++yl MDP0000031172 14 RGAWTALEDKILTAYIKAHGEGKWRSLPKRAGLKRCGKSCRLRWLNYL 61 89********************************************97 PP
2	Myb_DNA-binding	50.2	5.9e-16	67	111	1	47
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 rg+ + +E+el+v+++++lG++ W++Ia +++ gRt++++k++w++ MDP0000031172 67 RGNISGDEEELIVRLHNLLGNR-WSLIAGRLP-GRTDNEIKNYWNTT 111 6777889*************.*****.**********87 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	5.7E-23	5	64	IPR009057	Homeodomain-like
PROSITE profile	PS51294	14.968	9	61	IPR017930	Myb domain
SuperFamily	SSF46689	8.17E-28	12	108	IPR009057	Homeodomain-like
SMART	SM00717	1.6E-12	13	63	IPR001005	SANT/Myb domain
Pfam	PF00249	5.4E-14	14	61	IPR001005	SANT/Myb domain
CDD	cd00167	5.97E-9	16	61	No hit	No description
PROSITE profile	PS51294	22.696	62	116	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	6.6E-23	65	115	IPR009057	Homeodomain-like
SMART	SM00717	5.6E-13	66	114	IPR001005	SANT/Myb domain
Pfam	PF00249	8.5E-14	67	111	IPR001005	SANT/Myb domain
CDD	cd00167	1.67E-10	71	112	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 175 aa Download sequence Send to blast
MGRSPCCSKE GLNRGAWTAL EDKILTAYIK AHGEGKWRSL PKRAGLKRCG KSCRLRWLNY 60 LRPDIKRGNI SGDEEELIVR LHNLLGNRWS LIAGRLPGRT DNEIKNYWNT TLWKKSKADS 120 PSGSSKETSQ HPSKSVVKKK DVESKTTSTA AAKPLVIRTK ATRLSKILVP QNIPS

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	7e-25	12	112	25	124	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Mdo.12984	0.0	fruit

Functional Description ? help Back to Top
Source	Description
UniProt	Controls the expression of genes involved in anthocyanin biosynthesis. Regulates the expression of at least 3 structural genes: chalcone synthase, dihydroflavonol reductase and flavonol O(3) glucosyltransferase. C1 acts as a trans-acting factor.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KT601123	0.0	KT601123.1 Pyrus x bretschneideri cultivar Red Zaosu TT2-like transcription factor mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_028950763.1	1e-123	transcription repressor MYB6-like
Swissprot	P10290	6e-64	MYBC_MAIZE; Anthocyanin regulatory C1 protein
TrEMBL	A0A498HSQ4	1e-122	A0A498HSQ4_MALDO; Uncharacterized protein
STRING	XP_008367629.1	1e-123	(Malus domestica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31	34	817

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G16720.1	8e-63	myb domain protein 7

Link Out ? help Back to Top
Phytozome	MDP0000031172

Publications ? help Back to Top
Chen B,Wang X,Hu Y,Wang Y,Lin Z Ectopic expression of a c1-I allele from maize inhibits pigment formation in the flower of transgenic tobacco. Mol. Biotechnol., 2004. 26(3): p. 187-92 [PMID:15004287] Paz-Ares J,Ghosal D,Saedler H Molecular analysis of the C1-I allele from Zea mays: a dominant mutant of the regulatory C1 locus. EMBO J., 1990. 9(2): p. 315-21 [PMID:2303027] Cone KC,Burr FA,Burr B Molecular analysis of the maize anthocyanin regulatory locus C1. Proc. Natl. Acad. Sci. U.S.A., 1986. 83(24): p. 9631-5 [PMID:3025847] Paz-Ares J,Ghosal D,Wienand U,Peterson PA,Saedler H The regulatory c1 locus of Zea mays encodes a protein with homology to myb proto-oncogene products and with structural similarities to transcriptional activators. EMBO J., 1987. 6(12): p. 3553-8 [PMID:3428265] Scheffler B, et al. Molecular analysis of C1 alleles in Zea mays defines regions involved in the expression of this regulatory gene. Mol. Gen. Genet., 1994. 242(1): p. 40-8 [PMID:7904044] Franken P,Schrell S,Peterson PA,Saedler H,Wienand U Molecular analysis of protein domain function encoded by the myb-homologous maize genes C1, Zm 1 and Zm 38. Plant J., 1994. 6(1): p. 21-30 [PMID:7920701] Singer T,Gierl A,Peterson PA Three new dominant C1 suppressor alleles in Zea mays. Genet. Res., 1998. 71(2): p. 127-32 [PMID:9717435]