![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MDP0000123467 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 63aa MW: 7418.46 Da PI: 8.0752 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 60 | 4.5e-19 | 3 | 42 | 20 | 59 |
S-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 20 fprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
rsYYrCt++gC+vkk+v+r ++d+ +v++tYeg H+h+
MDP0000123467 3 ACRSYYRCTYQGCNVKKQVQRLNKDEGIVVTTYEGMHTHP 42
68*************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50811 | 17.327 | 1 | 44 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 4.1E-17 | 2 | 42 | IPR003657 | WRKY domain |
| SMART | SM00774 | 6.5E-11 | 2 | 43 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 4.84E-16 | 3 | 43 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 2.0E-14 | 3 | 42 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 63 aa Download sequence Send to blast |
MPACRSYYRC TYQGCNVKKQ VQRLNKDEGI VVTTYEGMHT HPIDKPSDNF EHILSQMQIY 60 THI |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008379098.3 | 3e-37 | probable WRKY transcription factor 75 | ||||
| Swissprot | Q9FYA2 | 4e-27 | WRK75_ARATH; Probable WRKY transcription factor 75 | ||||
| TrEMBL | A0A498J236 | 8e-36 | A0A498J236_MALDO; Uncharacterized protein | ||||
| STRING | XP_008379098.1 | 1e-36 | (Malus domestica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1156 | 34 | 110 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G13080.1 | 1e-29 | WRKY DNA-binding protein 75 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | MDP0000123467 |




