PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000127691
Common NameMdMYBA, MYB1, MYB10
Organism
Malus domestica
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB_related
Protein Properties Length: 87aa    MW: 10479 Da    PI: 9.8529
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000127691genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.2e-181259148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT eEd ll ++v+ +G g W+ ++ + g++R++k+c+ rw++yl
    MDP0000127691 12 KGAWTREEDNLLRQCVEIHGEGKWNQVSYKAGLNRCRKSCRQRWLNYL 59
                     79*********************************************7 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.606.2E-23762IPR009057Homeodomain-like
PROSITE profilePS5129424.845763IPR017930Myb domain
SMARTSM007171.1E-151161IPR001005SANT/Myb domain
PfamPF002494.3E-171259IPR001005SANT/Myb domain
SuperFamilySSF466894.23E-231387IPR009057Homeodomain-like
CDDcd001671.13E-101459No hitNo description
Gene3DG3DSA:1.10.10.606.1E-76386IPR009057Homeodomain-like
PROSITE profilePS512947.1146487IPR017930Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 87 aa     Download sequence    Send to blast
MEGYNENLSV RKGAWTREED NLLRQCVEIH GEGKWNQVSY KAGLNRCRKS CRQRWLNYLK  60
PNIKRGDFKE DEVDLIIRLH RLLGNRY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-121287781B-MYB
1h8a_C1e-1278722101MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.75131e-146fruit
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1, or BHLH042/TT8. {ECO:0000269|PubMed:15361138}.
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2795981e-143AB279598.1 Malus x domestica MdMYBA mRNA for myb transcription factor, complete cds.
GenBankAB5927471e-143AB592747.1 Malus x domestica MYB10b mRNA for MYB transcription factor 10, complete cds.
GenBankAB7440001e-143AB744000.1 Malus domestica MYB1 mRNA for MYB transcription factor, complete cds, cultivar: Fuji.
GenBankAB7440011e-143AB744001.1 Malus domestica MYB1 mRNA for MYB transcription factor, complete cds, cultivar: JPP35.
GenBankAB7440021e-143AB744002.1 Malus domestica MYB10 mRNA for MYB transcription factor, complete cds, cultivar: Maypole.
GenBankGU2704711e-143GU270471.1 Malus x domestica cultivar Ralls MYB1 transcription factor mRNA, complete cds.
GenBankKF7727891e-143KF772789.1 Malus hybrid cultivar cultivar Royalty MYB10 mRNA, complete cds.
GenBankKF7727901e-143KF772790.1 Malus hybrid cultivar cultivar Radiant MYB10 mRNA, complete cds.
GenBankKJ8453471e-143KJ845347.1 Malus hybrid cultivar MYB10 (MYB10) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001315777.11e-57transcription factor MYB113-like
RefseqXP_028963316.11e-57transcription factor MYB113-like isoform X1
RefseqXP_028963317.11e-57transcription factor MYB113-like isoform X1
SwissprotQ9FNV94e-34MY113_ARATH; Transcription factor MYB113
TrEMBLA0SQ353e-56A0SQ35_MALDO; MYB1 transcription factor
TrEMBLA0SQ372e-56A0SQ37_MALDO; MYB transcription factor
TrEMBLB5STY43e-56B5STY4_9ROSA; R2R3 MYB transcription factor 10
TrEMBLE2RZU23e-56E2RZU2_MALDO; MYB transcription factor 10
TrEMBLW5S2D43e-56W5S2D4_9ROSA; MYB10
STRINGXP_009370092.18e-55(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF3134817
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G66370.12e-36myb domain protein 113
Publications ? help Back to Top
  1. Takos AM, et al.
    Light-induced expression of a MYB gene regulates anthocyanin biosynthesis in red apples.
    Plant Physiol., 2006. 142(3): p. 1216-32
    [PMID:17012405]
  2. Ban Y, et al.
    Isolation and functional analysis of a MYB transcription factor gene that is a key regulator for the development of red coloration in apple skin.
    Plant Cell Physiol., 2007. 48(7): p. 958-70
    [PMID:17526919]
  3. Espley RV, et al.
    Multiple repeats of a promoter segment causes transcription factor autoregulation in red apples.
    Plant Cell, 2009. 21(1): p. 168-83
    [PMID:19151225]
  4. Umemura H,Otagaki S,Wada M,Kondo S,Matsumoto S
    Expression and functional analysis of a novel MYB gene, MdMYB110a_JP, responsible for red flesh, not skin color in apple fruit.
    Planta, 2013. 238(1): p. 65-76
    [PMID:23568403]
  5. Li T, et al.
    Jasmonic acid enhancement of anthocyanin accumulation is dependent on phytochrome A signaling pathway under far-red light in Arabidopsis.
    Biochem. Biophys. Res. Commun., 2014. 454(1): p. 78-83
    [PMID:25450360]
  6. Mondal SK,Roy S
    Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis.
    J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601
    [PMID:28490275]