![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MDP0000130524 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
| Family | TCP | ||||||||
| Protein Properties | Length: 147aa MW: 16687.8 Da PI: 10.6695 | ||||||||
| Description | TCP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | TCP | 80.7 | 3.9e-25 | 85 | 142 | 2 | 59 |
TCP 2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpai 59
g+kdrhsk++T +g+RdRRvRls+++a++++dLq++LG+ ++sk ++WLl + ++
MDP0000130524 85 FGGKDRHSKVCTIRGLRDRRVRLSVPTAIQLYDLQERLGLNQPSKVVDWLLDDDHNQV 142
689************************************************8866655 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51369 | 24.679 | 87 | 145 | IPR017887 | Transcription factor TCP subgroup |
| Pfam | PF03634 | 8.0E-24 | 87 | 145 | IPR005333 | Transcription factor, TCP |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 147 aa Download sequence Send to blast |
MGXERYYQLA KNLAIIGCRK LENGLPEGGE EHQKHSGGRL WSSTTSRECV AREANKISSN 60 PNLSRSSTLW PRLKDPRIVR ASRAFGGKDR HSKVCTIRGL RDRRVRLSVP TAIQLYDLQE 120 RLGLNQPSKV VDWLLDDDHN QVRLLPG |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5zkt_A | 2e-16 | 92 | 146 | 1 | 55 | Putative transcription factor PCF6 |
| 5zkt_B | 2e-16 | 92 | 146 | 1 | 55 | Putative transcription factor PCF6 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Mdo.16324 | 1e-118 | fruit| leaf | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed during ovule development (PubMed:25378179). {ECO:0000269|PubMed:25378179}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in cotyledons, particularly in the vascular region, in leaves, buds, flowers and immature siliques, and, to a lower extent, in roots. {ECO:0000269|PubMed:11161017, ECO:0000269|PubMed:17307931}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Plays a pivotal role in the control of morphogenesis of shoot organs by negatively regulating the expression of boundary-specific genes such as CUC genes, probably through the induction of miRNA (e.g. miR164). Binds to the 3'-ACC-5' repeats in the light-responsive promoter (LRP) of psbD, and activates its transcription. Participates in ovule develpment (PubMed:25378179). {ECO:0000269|PubMed:11161017, ECO:0000269|PubMed:17307931, ECO:0000269|PubMed:25378179}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KM501067 | 3e-47 | KM501067.1 Malus domestica TCP domain-containing protein 13 mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009365889.1 | 4e-49 | PREDICTED: transcription factor TCP13-like | ||||
| Refseq | XP_009365917.1 | 3e-49 | PREDICTED: transcription factor TCP13-like | ||||
| Swissprot | Q9S7W5 | 1e-36 | TCP13_ARATH; Transcription factor TCP13 | ||||
| TrEMBL | A0A498HII4 | 4e-47 | A0A498HII4_MALDO; Uncharacterized protein | ||||
| STRING | XP_008348175.1 | 1e-103 | (Malus domestica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF932 | 34 | 119 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G02150.1 | 2e-39 | plastid transcription factor 1 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | MDP0000130524 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




