![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MDP0000135652 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 200aa MW: 22570.5 Da PI: 8.8186 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 95.3 | 2.6e-30 | 21 | 71 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+ien s rqvtfskRrng+lKKA+ELSvLCdaevavi+fsstgklye+ss
MDP0000135652 21 KKIENLSSRQVTFSKRRNGLLKKAKELSVLCDAEVAVIVFSSTGKLYEFSS 71
68***********************************************96 PP
| |||||||
| 2 | K-box | 47.3 | 8.6e-17 | 101 | 173 | 11 | 83 |
K-box 11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkk 83
+a +++ +++ L++ei +L+ + ++ G++L+ slk+Lq+Le+qL +++ +++kK+e+l+e++++++ +
MDP0000135652 101 VMQATNSNCNVNALQNEIATLRLTCTRMTGKELDGVSLKDLQRLEDQLSEGILCVKDKKEEILMEKLKKSRLQ 173
45667888899***********999******************************************998865 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 32.618 | 13 | 73 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.8E-40 | 13 | 72 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.95E-43 | 14 | 84 | No hit | No description |
| SuperFamily | SSF55455 | 1.09E-32 | 14 | 87 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.8E-30 | 15 | 35 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 15 | 69 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 5.3E-27 | 22 | 69 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.8E-30 | 35 | 50 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.8E-30 | 50 | 71 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 5.4E-12 | 103 | 175 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 8.593 | 104 | 193 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 200 aa Download sequence Send to blast |
MNTENSTPAR KPLGRGRIEI KKIENLSSRQ VTFSKRRNGL LKKAKELSVL CDAEVAVIVF 60 SSTGKLYEFS STSMDHTLSR YNKGGLIEHP QKERSGDNEP VMQATNSNCN VNALQNEIAT 120 LRLTCTRMTG KELDGVSLKD LQRLEDQLSE GILCVKDKKE EILMEKLKKS RLQDFYLHDV 180 XLXAFNFDCI GNGCIRGFML |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 3e-22 | 13 | 110 | 1 | 93 | MEF2C |
| 5f28_B | 3e-22 | 13 | 110 | 1 | 93 | MEF2C |
| 5f28_C | 3e-22 | 13 | 110 | 1 | 93 | MEF2C |
| 5f28_D | 3e-22 | 13 | 110 | 1 | 93 | MEF2C |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: During the reproductive phase, accumulates in immature buds and at the base of the floral organs, and in the receptacle, ovules, anther filaments, and stigma and style of open flowers. Later observed in sporogenous tissue of anthers. During male gametogenesis, expressed in the microspores before they separate from each other. Later present at high levels within pollen grains up to stage 13 of flower development, when anthers dehisce. During carpel development, first detected in developing ovules. After fertilization, confined to globular structures or nodules of proliferating free nuclear endosperm required for embryo development. Disappears from the endosperm at to the heart stage of embryo development, when very little nuclear endosperm remains. Never detected in developing embryos at any stage. In young seedlings, present everywhere except in a portion of the hypocotyl and in newly emerging leaves. {ECO:0000269|PubMed:11115127, ECO:0000269|PubMed:17521410}. | |||||
| Uniprot | TISSUE SPECIFICITY: Mostly expressed in pollen, roots, flowers and siliques, and to a lower extent, in stems and leaves. Expressed in the endosperm and in developing male and female gametophytes. Also present in seedlings. {ECO:0000269|PubMed:11115127, ECO:0000269|PubMed:12837945, ECO:0000269|PubMed:12949148, ECO:0000269|PubMed:16028119, ECO:0000269|PubMed:17521410}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in the negative regulation of flowering, probably through the photoperiodic pathway. Prevents premature flowering. Downstream regulator of a subset of the MIKC* MADS-controlled genes required during pollen maturation. {ECO:0000269|PubMed:17521410, ECO:0000269|PubMed:18034896, ECO:0000269|PubMed:18799658}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KP164010 | 0.0 | KP164010.1 Pyrus pyrifolia clone PpAGL18 AGL18 MADS-box protein mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008351603.2 | 1e-123 | agamous-like MADS-box protein AGL18 | ||||
| Swissprot | Q9M2K8 | 7e-50 | AGL18_ARATH; Agamous-like MADS-box protein AGL18 | ||||
| TrEMBL | A0A498I396 | 1e-121 | A0A498I396_MALDO; Uncharacterized protein | ||||
| STRING | XP_008351603.1 | 1e-122 | (Malus domestica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF3582 | 32 | 60 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G57390.1 | 1e-45 | AGAMOUS-like 18 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | MDP0000135652 |




