![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MDP0000140324 | ||||||||
| Common Name | MYBR3 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 143aa MW: 16149 Da PI: 10.8544 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 46.3 | 1e-14 | 73 | 117 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
+WT+eE++l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
MDP0000140324 73 PWTEEEHKLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 117
8*******************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 17.703 | 66 | 122 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 2.51E-17 | 68 | 123 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 7.5E-17 | 69 | 120 | IPR006447 | Myb domain, plants |
| SMART | SM00717 | 2.4E-10 | 70 | 120 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 8.3E-12 | 72 | 116 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 6.1E-12 | 73 | 117 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 2.67E-10 | 73 | 117 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 143 aa Download sequence Send to blast |
MLFGVRLVVD SMRKSVSLNN LSQYEQPQEA ASNNGNNGTA AGKDDAAPGY ASENDVVHNS 60 GGNRERERKR GVPWTEEEHK LFLLGLQKVG KGDWRGISRN FVKTRTPTQV ASHAQKYYLR 120 RSNLNRRRRR SSLFDITTDT VTI |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Mdo.11980 | 0.0 | bud| cell culture| fruit| leaf| root| stem | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Binds selectively to the DNA sequence 5'-[GA]GATAA-3' and may act as a transcription factor involved in the regulation of drought-responsive genes. Enhances stomatal closure in response to abscisic acid (ABA). Confers drought and salt tolerance. {ECO:0000269|PubMed:21030505}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Up-regulated by drought, high salinity, and ABA. {ECO:0000269|PubMed:21030505}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AY196776 | 0.0 | AY196776.1 Malus xiaojinensis transcription factor Myb1 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001315795.1 | 1e-101 | transcription factor MYB1R1-like | ||||
| Swissprot | Q2V9B0 | 5e-55 | MY1R1_SOLTU; Transcription factor MYB1R1 | ||||
| TrEMBL | A0A498HWU5 | 1e-99 | A0A498HWU5_MALDO; Uncharacterized protein | ||||
| TrEMBL | D9ZJ82 | 1e-99 | D9ZJ82_MALDO; MYBR domain class transcription factor | ||||
| STRING | XP_008360819.1 | 1e-100 | (Malus domestica) | ||||
| STRING | XP_008360820.1 | 1e-102 | (Malus domestica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF4248 | 31 | 54 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G74840.2 | 1e-52 | MYB_related family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | MDP0000140324 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




