![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MDP0000140493 | ||||||||
| Common Name | LOC103425475 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 223aa MW: 25570.4 Da PI: 9.1414 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 101.9 | 8.7e-32 | 5 | 78 | 54 | 128 |
NAM 54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
+e+ewyfF++rd+ky++g r+nrat sgyWkatg+dk+++s +++ vg+kk Lvfy+gr pkg+k+dW+mheyrl
MDP0000140493 5 GENEWYFFTPRDRKYPNGIRPNRATVSGYWKATGTDKAIYS-ESKYVGVKKALVFYQGRPPKGVKSDWIMHEYRL 78
689**************************************.999****************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 41.004 | 1 | 106 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 2.75E-38 | 4 | 106 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.4E-14 | 8 | 78 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 223 aa Download sequence Send to blast |
KAEFGENEWY FFTPRDRKYP NGIRPNRATV SGYWKATGTD KAIYSESKYV GVKKALVFYQ 60 GRPPKGVKSD WIMHEYRLGD TRKQQANKQL GSMRLDDWVL CRIYKKRQPG KAYLDXKVEE 120 DEKIEMTTPE TAKXNEEQMM LKFPRTCSIT SLLDMDYLGP MSQLLGDNNS GYDFQSSLAG 180 AGAGHAQMFQ FGEMPNYQTT TDSGKFQAMA QTNVLNHQPW FGP |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 4e-46 | 1 | 107 | 65 | 166 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 4e-46 | 1 | 107 | 65 | 166 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 4e-46 | 1 | 107 | 65 | 166 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 4e-46 | 1 | 107 | 65 | 166 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 4e-46 | 1 | 107 | 68 | 169 | NAC domain-containing protein 19 |
| 3swm_B | 4e-46 | 1 | 107 | 68 | 169 | NAC domain-containing protein 19 |
| 3swm_C | 4e-46 | 1 | 107 | 68 | 169 | NAC domain-containing protein 19 |
| 3swm_D | 4e-46 | 1 | 107 | 68 | 169 | NAC domain-containing protein 19 |
| 3swp_A | 4e-46 | 1 | 107 | 68 | 169 | NAC domain-containing protein 19 |
| 3swp_B | 4e-46 | 1 | 107 | 68 | 169 | NAC domain-containing protein 19 |
| 3swp_C | 4e-46 | 1 | 107 | 68 | 169 | NAC domain-containing protein 19 |
| 3swp_D | 4e-46 | 1 | 107 | 68 | 169 | NAC domain-containing protein 19 |
| 4dul_A | 4e-46 | 1 | 107 | 65 | 166 | NAC domain-containing protein 19 |
| 4dul_B | 4e-46 | 1 | 107 | 65 | 166 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Mdo.9859 | 0.0 | fruit| leaf| stem | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in roots, stem, flowers, and leaves. {ECO:0000269|PubMed:29760199}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in roots, stem, flowers, and leaves. {ECO:0000269|PubMed:29760199}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence and reduces fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. {ECO:0000269|PubMed:29760199}. | |||||
| UniProt | Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence (developmental, light-induced and ABA-induced senescence) and regulates fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. Activates the expression of senescence and ABA associated genes including NCED1, ABCG40, CYP707A2, SAG113, SGR1 and PAO, by directly binding to their promoters. {ECO:0000269|PubMed:29760199}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. {ECO:0000269|PubMed:29760199}. | |||||
| UniProt | INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. Induced by abscisic acid (ABA). {ECO:0000269|PubMed:29760199}. | |||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KF198127 | 0.0 | KF198127.1 Malus hupehensis NAC domain protein (NAC120) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008368238.2 | 1e-166 | NAC domain-containing protein 1-like | ||||
| Swissprot | K4BNG7 | 8e-78 | NAP2_SOLLC; NAC domain-containing protein 2 | ||||
| Swissprot | K4BWV2 | 8e-78 | NAP1_SOLLC; NAC domain-containing protein 1 | ||||
| TrEMBL | A0A498HKM6 | 1e-165 | A0A498HKM6_MALDO; Uncharacterized protein | ||||
| STRING | XP_008340319.1 | 1e-166 | (Malus domestica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF4103 | 32 | 62 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G69490.1 | 8e-77 | NAC-like, activated by AP3/PI | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | MDP0000140493 |
| Entrez Gene | 103425475 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




