PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MDP0000167208

Organism

Malus domestica

Taxonomic ID

3750

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus

Family

NAC

Protein Properties

Length: 180aa MW: 20752.6 Da PI: 8.2127

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MDP0000167208	genome	GDR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	171.9	2e-53	25	151	2	128
NAM 2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.k 96 +pGfrFhPtdeel+++yL+ kv + ++ i+evd++++ePw+Lp +k +e+ewyfFs rd+ky+tg r+nrat +gyWkatgkd++v+s+ + MDP0000167208 25 QPGFRFHPTDEELITFYLASKVYNGSFCG-VRIAEVDLNRCEPWELPDVAKMGEREWYFFSLRDRKYPTGMRTNRATGAGYWKATGKDRQVFSAsT 119 69**********************777.45***********8888899**********************************9878 PP NAM 97 gelvglkktLvfykgrapkgektdWvmheyrl 128 g+l g+kktLvfykgrap+g+kt+Wvmheyrl MDP0000167208 120 GALLGMKKTLVFYKGRAPRGHKTKWVMHEYRL 151 889*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	2.35E-57	21	156	IPR003441	NAC domain
PROSITE profile	PS51005	53.337	24	167	IPR003441	NAC domain
Pfam	PF02365	4.0E-28	26	151	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 180 aa Download sequence Send to blast
MLGIGMEEIM SELMSGEDEN GQGFQPGFRF HPTDEELITF YLASKVYNGS FCGVRIAEVD 60 LNRCEPWELP DVAKMGEREW YFFSLRDRKY PTGMRTNRAT GAGYWKATGK DRQVFSASTG 120 ALLGMKKTLV FYKGRAPRGH KTKWVMHEYR LDGHFSSYRH DCQVWTHNPY LHPCTCTPMA

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	6e-48	23	151	14	140	Stress-induced transcription factor NAC1
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: First expressed at the globular stage, mostly in the apical part of the embryo. During the triangular stage, confined to the boundary of emerging cotyledons. Later restricted to the center of the apical part of the embryo and to seedling apex, at the boundaries of the cotyledon margins and the boundaries between the SAM and the cotyledons. Localized in a one-cell-wide ring at the boundary between trichomes or lateral roots and epidermis. Accumulates at the boundaries between leaf primordia and the shoot meristem and between floral primordia and the inflorescence meristem. Found in the adaxial axils of secondary inflorescences and pedicels, and in axiallary buds. In flowers, expressed in a ring at the bases of sepals and petals. In carpels, confined to the boundaries between ovule primordia. In ovules, localized in a ring at the boundary between the nucellus and the chalaza. In the mature embryo sac, detected in the two polar nuclei of the central cell. {ECO:0000269\|PubMed:12837947, ECO:0000269\|PubMed:17122068}.
Uniprot	TISSUE SPECIFICITY: In a general manner, present at the boundaries between mersitems and araising primordia. {ECO:0000269\|PubMed:12837947}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269\|PubMed:12837947, ECO:0000269\|PubMed:17122068}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269\|PubMed:16854978}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KF198121	0.0	KF198121.1 Malus hupehensis NAC domain protein (NAC80) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008373384.2	1e-120	protein CUP-SHAPED COTYLEDON 3
Swissprot	Q9S851	5e-83	NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBL	A0A498JSG5	1e-118	A0A498JSG5_MALDO; Uncharacterized protein
STRING	XP_008346452.1	1e-135	(Malus domestica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF7888	33	47

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G76420.1	2e-85	NAC family protein

Link Out ? help Back to Top
Phytozome	MDP0000167208

Publications ? help Back to Top
Chen C, et al. Transcriptome profiling reveals roles of meristem regulators and polarity genes during fruit trichome development in cucumber (Cucumis sativus L.). J. Exp. Bot., 2014. 65(17): p. 4943-58 [PMID:24962999] Gonçalves B, et al. A conserved role for CUP-SHAPED COTYLEDON genes during ovule development. Plant J., 2015. 83(4): p. 732-42 [PMID:26119568] Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis. Plant J., 2017. 90(3): p. 435-446 [PMID:28161901] Espinosa-Ruiz A, et al. TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana. Development, 2017. 144(9): p. 1619-1628 [PMID:28320734] Koyama T,Sato F,Ohme-Takagi M Roles of miR319 and TCP Transcription Factors in Leaf Development. Plant Physiol., 2017. 175(2): p. 874-885 [PMID:28842549]