PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000175446
Organism
Malus domestica
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 76aa    MW: 8851.42 Da    PI: 6.9384
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000175446genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM48.43e-15646142
            NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykv 42
                   lppGfrFhPtdeelv +yL +k++g+++el e+i++vd+yk+
  MDP0000175446  6 LPPGFRFHPTDEELVAYYLDQKINGRTIEL-EIIPKVDLYKC 46
                   79****************************.99*******97 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.92E-15346IPR003441NAC domain
PROSITE profilePS5100514.645676IPR003441NAC domain
PfamPF023657.6E-9739IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 76 aa     Download sequence    Send to blast
MAPMSLPPGF RFHPTDEELV AYYLDQKING RTIELEIIPK VDLYKCLLIH VFIIGMHHGF  60
DYKFVNFNNK LQAPVC
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in a few sieve element cells before enucleation and in phloem-pole pericycle cells. {ECO:0000269|PubMed:25081480}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAM4656842e-37AM465684.2 Vitis vinifera contig VV78X155772.10, whole genome shotgun sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008371963.17e-26NAC domain-containing protein 86-like
SwissprotQ9FFI55e-22NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A498IZE72e-24A0A498IZE7_MALDO; Uncharacterized protein
TrEMBLA0A498JYR82e-24A0A498JYR8_MALDO; Uncharacterized protein
STRINGXP_008371963.13e-25(Malus domestica)
STRINGXP_008383208.13e-25(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF114331739
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54330.19e-28NAC domain containing protein 20
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]