![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MDP0000203462 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
| Family | BES1 | ||||||||
| Protein Properties | Length: 103aa MW: 11572.4 Da PI: 9.6556 | ||||||||
| Description | BES1 family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF822 | 159.8 | 1.8e-49 | 5 | 76 | 1 | 72 |
DUF822 1 ggsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkg 72
g+sgr ptwkErEnnkrRERrRRaiaak+y+GLRaqG yklpk++DnneVlkALc+eAGwvve+DGttyrk
MDP0000203462 5 GSSGRLPTWKERENNKRRERRRRAIAAKMYSGLRAQGSYKLPKHCDNNEVLKALCAEAGWVVEEDGTTYRKI 76
689*******************************************************************85 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF05687 | 1.8E-45 | 6 | 77 | IPR008540 | BES1/BZR1 plant transcription factor, N-terminal |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 103 aa Download sequence Send to blast |
MTGGGSSGRL PTWKERENNK RRERRRRAIA AKMYSGLRAQ GSYKLPKHCD NNEVLKALCA 60 EAGWVVEEDG TTYRKISACK IILDLVLVDF VNPCFLVEIP AGF |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5zd4_A | 9e-26 | 9 | 80 | 372 | 441 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_B | 9e-26 | 9 | 80 | 372 | 441 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_C | 9e-26 | 9 | 80 | 372 | 441 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| 5zd4_D | 9e-26 | 9 | 80 | 372 | 441 | Maltose-binding periplasmic protein,Protein BRASSINAZOLE-RESISTANT 1 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Mdo.12130 | 1e-104 | bud| cell culture| fruit| leaf| stem | ||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008338783.2 | 7e-36 | BES1/BZR1 homolog protein 2-like | ||||
| Refseq | XP_010675300.1 | 3e-36 | PREDICTED: BES1/BZR1 homolog protein 4 | ||||
| Swissprot | Q9S7F3 | 3e-28 | BEH1_ARATH; BES1/BZR1 homolog protein 1 | ||||
| TrEMBL | A0A2P6RMR5 | 2e-45 | A0A2P6RMR5_ROSCH; Putative transcription factor BES/BZR family | ||||
| STRING | XP_010675300.1 | 1e-35 | (Beta vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF15152 | 11 | 13 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G50750.1 | 4e-30 | BES1/BZR1 homolog 1 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | MDP0000203462 |




