![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MDP0000204989 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
| Family | bHLH | ||||||||
| Protein Properties | Length: 95aa MW: 10866.2 Da PI: 6.9578 | ||||||||
| Description | bHLH family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HLH | 28.1 | 3.8e-09 | 21 | 61 | 14 | 54 |
HHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
HLH 14 driNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
d+i++ +++L+ llP++ ++++ +s ++iLe+++ YI+ L
MDP0000204989 21 DEIKELISKLQPLLPQLHHTRNAPVSASSILEETCSYIRRL 61
689*************88*********************99 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50888 | 9.693 | 7 | 61 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Pfam | PF00010 | 2.0E-6 | 21 | 61 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Gene3D | G3DSA:4.10.280.10 | 4.7E-8 | 21 | 76 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| SuperFamily | SSF47459 | 1.57E-8 | 21 | 76 | IPR011598 | Myc-type, basic helix-loop-helix (bHLH) domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 95 aa Download sequence Send to blast |
MSSRRPSSSS SSSRMSKPSD DEIKELISKL QPLLPQLHHT RNAPVSASSI LEETCSYIRR 60 LHREVEDLSQ RISRLLDSAD ISDVDEELIR RLLQH |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Mdo.16415 | 1e-51 | bud| fruit | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Atypical and probable non DNA-binding bHLH transcription factor that integrates multiple signaling pathways to regulate cell elongation and plant development. May have a regulatory role in various aspects of gibberellin-dependent growth and development. {ECO:0000269|PubMed:16527868}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008393139.2 | 7e-59 | transcription factor PRE6-like | ||||
| Swissprot | Q9LJX1 | 7e-22 | PRE5_ARATH; Transcription factor PRE5 | ||||
| TrEMBL | A0A498I2Z4 | 6e-57 | A0A498I2Z4_MALDO; Uncharacterized protein | ||||
| STRING | XP_008351836.1 | 1e-48 | (Malus domestica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF10624 | 24 | 39 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G26945.1 | 8e-23 | bHLH family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | MDP0000204989 |




