PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MDP0000206586

Organism

Malus domestica

Taxonomic ID

3750

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus

Family

Dof

Protein Properties

Length: 107aa MW: 11917.4 Da PI: 10.876

Description

Dof family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MDP0000206586	genome	GDR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	zf-Dof	122.9	1.1e-38	32	91	3	62
zf-Dof 3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 ++alkc+rCds ntkfCyynny+ sqPr+fCkaCrryWtkGG lrnvPvGgg+rk k+s+ MDP0000206586 32 QHALKCSRCDSLNTKFCYYNNYNFSQPRHFCKACRRYWTKGGVLRNVPVGGGCRKTKRSK 91 6789****************************************************9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD007478	3.0E-25	30	89	IPR003851	Zinc finger, Dof-type
Pfam	PF02701	8.9E-33	33	89	IPR003851	Zinc finger, Dof-type
PROSITE profile	PS50884	28.584	35	89	IPR003851	Zinc finger, Dof-type
PROSITE pattern	PS01361	0	37	73	IPR003851	Zinc finger, Dof-type

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 107 aa Download sequence Send to blast
MQDIHSVRGG GRFFGGSGGG DPRLRPHQHP NQHALKCSRC DSLNTKFCYY NNYNFSQPRH 60 FCKACRRYWT KGGVLRNVPV GGGCRKTKRS KTKNSSSSSP ISSPSPE

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Mdo.12388	1e-164	fruit\| leaf\| root\| stem

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed in germinating seeds up to 5 days after imbibition. {ECO:0000269\|PubMed:11470159}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that may transactivate seed storage protein genes in developing seeds. {ECO:0000250\|UniProtKB:Q6K537}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by gibberellin. {ECO:0000269\|PubMed:11470159}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	DQ857254	2e-60	DQ857254.1 Glycine max Dof4 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_009346227.1	1e-51	PREDICTED: dof zinc finger protein DOF5.4
Swissprot	Q6Z345	4e-38	DOF4_ORYSJ; Dof zinc finger protein 4
TrEMBL	A0A2C9VP18	9e-49	A0A2C9VP18_MANES; Uncharacterized protein
TrEMBL	D9ZIX7	8e-48	D9ZIX7_MALDO; DOF domain class transcription factor
STRING	XP_008350691.1	9e-74	(Malus domestica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF5998	30	50

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G60850.1	2e-37	OBF binding protein 4

Link Out ? help Back to Top
Phytozome	MDP0000206586

Publications ? help Back to Top
Washio K Identification of Dof proteins with implication in the gibberellin-regulated expression of a peptidase gene following the germination of rice grains. Biochim. Biophys. Acta, 2001. 1520(1): p. 54-62 [PMID:11470159] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764]