PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MDP0000218227

Organism

Malus domestica

Taxonomic ID

3750

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus

Family

M-type_MADS

Protein Properties

Length: 92aa MW: 10593.5 Da PI: 9.7288

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MDP0000218227	genome	GDR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	85.1	4.2e-27	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k i++k +rqvtfskRr g++KKA ELSvLC++ev ++ifs +g+lye++s MDP0000218227 9 KLIDDKLRRQVTFSKRRSGLIKKARELSVLCGVEVGLVIFSAKGRLYEFCS 59 569**********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.9E-34	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	29.38	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	2.51E-33	2	59	No hit	No description
SuperFamily	SSF55455	1.83E-27	2	71	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.0E-26	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	3.4E-24	11	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.0E-26	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.0E-26	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 92 aa Download sequence Send to blast
MGRGKVELKL IDDKLRRQVT FSKRRSGLIK KARELSVLCG VEVGLVIFSA KGRLYEFCSG 60 ESARQELDSW LPIYLFFPFS VWEPDPLCIQ KI

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1tqe_P	2e-16	1	64	1	64	Myocyte-specific enhancer factor 2B
1tqe_Q	2e-16	1	64	1	64	Myocyte-specific enhancer factor 2B
1tqe_R	2e-16	1	64	1	64	Myocyte-specific enhancer factor 2B
1tqe_S	2e-16	1	64	1	64	Myocyte-specific enhancer factor 2B
6c9l_A	2e-16	1	64	1	64	Myocyte-specific enhancer factor 2B
6c9l_B	2e-16	1	64	1	64	Myocyte-specific enhancer factor 2B
6c9l_C	2e-16	1	64	1	64	Myocyte-specific enhancer factor 2B
6c9l_D	2e-16	1	64	1	64	Myocyte-specific enhancer factor 2B
6c9l_E	2e-16	1	64	1	64	Myocyte-specific enhancer factor 2B
6c9l_F	2e-16	1	64	1	64	Myocyte-specific enhancer factor 2B
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Mdo.14463	1e-100	bud\| leaf

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expressed at early stage of flower development in the spikelet (rice flower) primordia and later in stamen and pistil primordia. Expressed during ovule development in the inner and outer integuments. {ECO:0000269\|PubMed:12395189, ECO:0000269\|PubMed:9065695}.
Uniprot	TISSUE SPECIFICITY: Expressed in lodicules, stamens and carpels. {ECO:0000269\|PubMed:12395189, ECO:0000269\|PubMed:9065695, ECO:0000269\|PubMed:9339904}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. May be involved in the control of flowering time. {ECO:0000269\|PubMed:9339904, ECO:0000269\|Ref.9}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AB524589	5e-85	AB524589.1 Pyrus pyrifolia var. culta FLC mRNA for flowering locus C-like protein, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_028965252.1	7e-36	truncated transcription factor CAULIFLOWER A-like
Swissprot	Q9SAR1	1e-25	MADS8_ORYSJ; MADS-box transcription factor 8
TrEMBL	D4QDZ2	2e-34	D4QDZ2_PYRPY; Flowering locus C-like protein
STRING	XP_009344924.1	4e-32	(Pyrus x bretschneideri)
STRING	EMJ17361	5e-33	(Prunus persica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF119	33	360

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G03710.3	4e-27	MIKC_MADS family protein

Link Out ? help Back to Top
Phytozome	MDP0000218227

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Jang YH, et al. Survey of rice proteins interacting with OsFCA and OsFY proteins which are homologous to the Arabidopsis flowering time proteins, FCA and FY. Plant Cell Physiol., 2009. 50(8): p. 1479-92 [PMID:19561057] Cui R, et al. Functional conservation and diversification of class E floral homeotic genes in rice (Oryza sativa). Plant J., 2010. 61(5): p. 767-81 [PMID:20003164] Bai X, et al. Regulatory role of FZP in the determination of panicle branching and spikelet formation in rice. Sci Rep, 2016. 6: p. 19022 [PMID:26744119]