PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MDP0000253357

Organism

Malus domestica

Taxonomic ID

3750

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus

Family

ZF-HD

Protein Properties

Length: 98aa MW: 11044.5 Da PI: 8.6918

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MDP0000253357	genome	GDR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	106	2.2e-33	27	82	4	60
ZF-HD_dimer 4 vrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRreveee 60 vrY eC+kNhAa+lGg+a+DGC+Efm+s geegt++al+CaACgCHR+FHR+eve+e MDP0000253357 27 VRYGECQKNHAAKLGGYAIDGCREFMAS-GEEGTTEALTCAACGCHRSFHRKEVETE 82 89***********************9.999*******************9986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF04770	7.4E-31	27	79	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	1.8E-27	28	79	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	26.258	29	78	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDom	PD125774	1.0E-26	29	91	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 98 aa Download sequence Send to blast
MKKRQVVVKR DRSERNSSTS SSMVRIVRYG ECQKNHAAKL GGYAIDGCRE FMASGEEGTT 60 EALTCAACGC HRSFHRKEVE TEVVCEYSPP SSYRKWCT

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Mostly expressed in stems, flowers and siliques, and, to a lower extent, in inflorescence. {ECO:0000269\|PubMed:16412086}.

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008374543.1	2e-67	mini zinc finger protein 3-like
Swissprot	Q9LJW5	2e-38	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	M5WFS6	2e-50	M5WFS6_PRUPE; Uncharacterized protein
STRING	XP_008374543.1	6e-67	(Malus domestica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1550	34	100

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G74660.1	5e-37	mini zinc finger 1

Link Out ? help Back to Top
Phytozome	MDP0000253357

Publications ? help Back to Top
Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]