![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MDP0000317257 | ||||||||
| Common Name | LOC103405833 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 88aa MW: 10402.7 Da PI: 9.3909 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 49.5 | 1e-15 | 13 | 60 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT eEd+ll ++++ +G g W+ +++ g++ ++k+c++rw++yl
MDP0000317257 13 KGAWTREEDDLLRQCIEIHGEGKWRQLPNKAGLNTCRKSCRLRWLNYL 60
79*********************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 21.336 | 8 | 64 | IPR017930 | Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.4E-20 | 11 | 63 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 2.1E-12 | 12 | 62 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.7E-14 | 13 | 60 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 8.98E-21 | 14 | 88 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 9.99E-9 | 15 | 60 | No hit | No description |
| PROSITE profile | PS50090 | 3.903 | 61 | 88 | IPR017877 | Myb-like domain |
| Gene3D | G3DSA:1.10.10.60 | 1.6E-6 | 64 | 87 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 88 aa Download sequence Send to blast |
MEGCNVNLSV XRKGAWTREE DDLLRQCIEI HGEGKWRQLP NKAGLNTCRK SCRLRWLNYL 60 KPNIKRGDFT EDEVDLTIRL HKLLGNRY |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription activator, when associated with BHLH002/EGL3/MYC146, BHLH012/MYC1, or BHLH042/TT8. {ECO:0000269|PubMed:15361138}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JN711474 | 1e-143 | JN711474.1 Malus x domestica cultivar Golden Delicious MYB110b mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001280759.1 | 6e-58 | uncharacterized protein LOC103405833 | ||||
| Swissprot | Q9FNV9 | 6e-34 | MY113_ARATH; Transcription factor MYB113 | ||||
| TrEMBL | K4F7L6 | 1e-56 | K4F7L6_MALDO; MYB110b | ||||
| STRING | XP_008343062.1 | 2e-56 | (Malus domestica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF31 | 34 | 817 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G66370.1 | 3e-36 | myb domain protein 113 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | MDP0000317257 |
| Entrez Gene | 103405833 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




