![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MDP0000325078 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
| Family | HSF | ||||||||
| Protein Properties | Length: 124aa MW: 13796.4 Da PI: 6.2264 | ||||||||
| Description | HSF family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | HSF_DNA-bind | 78.2 | 1.4e-24 | 57 | 115 | 2 | 60 |
HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
HSF_DNA-bind 2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
Fl+k+y++++d+ ++++sws+ g sfvv+d++ f ++LpkyFkh+nf+SFvRQLn+Y
MDP0000325078 57 FLNKTYDMVDDPGSNRVVSWSKGGASFVVWDPHAFVMSLLPKYFKHNNFSSFVRQLNTY 115
9*********************************************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.10 | 6.9E-27 | 51 | 115 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| SMART | SM00415 | 4.6E-23 | 53 | 123 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| SuperFamily | SSF46785 | 1.9E-22 | 53 | 116 | IPR011991 | Winged helix-turn-helix DNA-binding domain |
| Pfam | PF00447 | 6.2E-21 | 57 | 115 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 5.9E-15 | 57 | 80 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 5.9E-15 | 95 | 107 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| PRINTS | PR00056 | 5.9E-15 | 108 | 120 | IPR000232 | Heat shock factor (HSF)-type, DNA-binding |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 124 aa Download sequence Send to blast |
MTTAALPFFL HFNSNPLKEE YPGSSSSQPC PGFDQTVMMI PPPQPMEGLN DTGPPPFLNK 60 TYDMVDDPGS NRVVSWSKGG ASFVVWDPHA FVMSLLPKYF KHNNFSSFVR QLNTYVSVFS 120 PPSX |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5d8k_B | 1e-17 | 55 | 115 | 3 | 63 | Heat shock factor protein 2 |
| 5d8l_B | 1e-17 | 55 | 115 | 3 | 63 | Heat shock factor protein 2 |
| 5d8l_D | 1e-17 | 55 | 115 | 3 | 63 | Heat shock factor protein 2 |
| 5d8l_F | 1e-17 | 55 | 115 | 3 | 63 | Heat shock factor protein 2 |
| 5d8l_H | 1e-17 | 55 | 115 | 3 | 63 | Heat shock factor protein 2 |
| 5hdk_A | 1e-17 | 55 | 115 | 8 | 68 | Heat shock factor protein 2 |
| 5hdk_B | 1e-17 | 55 | 115 | 8 | 68 | Heat shock factor protein 2 |
| 5hdk_C | 1e-17 | 55 | 115 | 8 | 68 | Heat shock factor protein 2 |
| 5hdk_D | 1e-17 | 55 | 115 | 8 | 68 | Heat shock factor protein 2 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE). | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_018506113.1 | 1e-72 | PREDICTED: heat stress transcription factor A-6b | ||||
| Swissprot | Q9M1V5 | 3e-35 | HFA7B_ARATH; Heat stress transcription factor A-7b | ||||
| TrEMBL | A0A498K920 | 1e-66 | A0A498K920_MALDO; Uncharacterized protein | ||||
| STRING | XP_008363653.1 | 2e-85 | (Malus domestica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1592 | 33 | 95 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G63350.1 | 1e-37 | HSF family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | MDP0000325078 |




