PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MDP0000364750

Organism

Malus domestica

Taxonomic ID

3750

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus

Family

NAC

Protein Properties

Length: 99aa MW: 11624.8 Da PI: 5.0047

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MDP0000364750	genome	GDR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	57	6.7e-18	51	97	1	48
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48 lppGfrFhPtdeel+++yLk +++++++++ ++i+evdiyk++Pw+Lp MDP0000364750 51 LPPGFRFHPTDEELIMFYLKYQATSRPCPV-SIIPEVDIYKFDPWELP 97 79**************************.89************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	5.23E-21	43	98	IPR003441	NAC domain
PROSITE profile	PS51005	21.919	51	99	IPR003441	NAC domain
Pfam	PF02365	8.3E-7	52	91	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 99 aa Download sequence Send to blast
VSPLXLQPQN LIQAAAKQFS EFLIFFLFFX FFILFFSERA PKMEAKQSSQ LPPGFRFHPT 60 DEELIMFYLK YQATSRPCPV SIIPEVDIYK FDPWELPGX

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	2e-16	44	97	8	61	Stress-induced transcription factor NAC1
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Mdo.9859	1e-146	fruit\| leaf\| stem

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in roots, stem, flowers, and leaves. {ECO:0000269\|PubMed:29760199}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that binds DNA motifs 5'-CGT[AG](5N)NACG[ACT][AC][AT][ACG][ACT]-3' and 5'-CACG[ACT][AC][AT][AGT][CT]-3' in target genes promoters. Promotes leaf senescence and reduces fruit yield and sugar content, probably by establishing abscisic acid (ABA) homeostasis. {ECO:0000269\|PubMed:29760199}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Accumulates during age-dependent and dark-induced leaf senescence. {ECO:0000269\|PubMed:29760199}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KF198127	1e-82	KF198127.1 Malus hupehensis NAC domain protein (NAC120) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008368238.2	9e-33	NAC domain-containing protein 1-like
Swissprot	K4BWV2	3e-28	NAP1_SOLLC; NAC domain-containing protein 1
TrEMBL	A0A498HKM6	2e-31	A0A498HKM6_MALDO; Uncharacterized protein
STRING	XP_008361781.1	3e-32	(Malus domestica)
STRING	XP_008368238.1	3e-32	(Malus domestica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF11433	17	39

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69490.1	2e-27	NAC-like, activated by AP3/PI

Link Out ? help Back to Top
Phytozome	MDP0000364750

Publications ? help Back to Top
Tomato Genome Consortium The tomato genome sequence provides insights into fleshy fruit evolution. Nature, 2012. 485(7400): p. 635-41 [PMID:22660326] Ma X, et al. The NAC Transcription Factor SlNAP2 Regulates Leaf Senescence and Fruit Yield in Tomato. Plant Physiol., 2018. 177(3): p. 1286-1302 [PMID:29760199]