PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MDP0000403071

Organism

Malus domestica

Taxonomic ID

3750

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus

Family

MYB_related

Protein Properties

Length: 47aa MW: 5064.74 Da PI: 7.2542

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MDP0000403071	genome	GDR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	37.7	4.8e-12	14	44	1	31
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartm 31 +g+WT+eEd +lv +++++G+g+W++++ MDP0000403071 14 KGPWTPEEDIILVSYIQEHGPGNWRSVPTNT 44 79*************************9865 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	5.3E-14	5	43	IPR009057	Homeodomain-like
SuperFamily	SSF46689	1.51E-10	8	43	IPR009057	Homeodomain-like
PROSITE profile	PS51294	16.897	9	46	IPR017930	Myb domain
Pfam	PF00249	2.1E-10	14	44	IPR001005	SANT/Myb domain
CDD	cd00167	1.75E-7	16	46	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 47 aa Download sequence Send to blast
MGRPPCCDKV GVKKGPWTPE EDIILVSYIQ EHGPGNWRSV PTNTGN*

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Mdo.15735	3e-72	bud\| leaf\| stem

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: During seed development, gradually down-regulated towards the onset of ripening (veraison). During berry skin development, dramatic decrease to full repression at veraison, followed by a slight increase towards ripening. In flowers, barely detectable in stamens, at the interface of filaments and anthers. {ECO:0000269\|PubMed:22018045}.
Uniprot	TISSUE SPECIFICITY: Restricted to stomatal guard cells. Mostly expressed in leaves, cotyledons, hypocotyls, seeds and ripened berry skins. {ECO:0000269\|PubMed:22018045}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light). {ECO:0000269\|PubMed:22018045}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Repressed by abscisic acid (ABA) and osmotic stress (salt stress). {ECO:0000269\|PubMed:22018045}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KM001670	1e-59	KM001670.1 Pyrus x bretschneideri transcription factor MYB31 (MYB31) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_017621802.1	4e-28	PREDICTED: myb-related protein 306-like isoform X1
Swissprot	B3VTV7	6e-27	MYB60_VITVI; Transcription factor MYB60
TrEMBL	A0A0D2T347	5e-26	A0A0D2T347_GOSRA; Uncharacterized protein
TrEMBL	A0A224MLP3	6e-26	A0A224MLP3_FRAAN; Transcription factor MYB30
TrEMBL	D7KK40	2e-26	D7KK40_ARALL; Uncharacterized protein
STRING	XP_004137409.1	5e-27	(Cucumis sativus)
STRING	fgenesh1_pg.C_scaffold_1003053	3e-27	(Arabidopsis lyrata)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G08810.1	2e-29	myb domain protein 60

Link Out ? help Back to Top
Phytozome	MDP0000403071

Publications ? help Back to Top
Jaillon O, et al. The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature, 2007. 449(7161): p. 463-7 [PMID:17721507]