![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MDP0000420150 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
| Family | GRAS | ||||||||
| Protein Properties | Length: 111aa MW: 12554.6 Da PI: 4.2459 | ||||||||
| Description | GRAS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GRAS | 41.7 | 1.8e-13 | 28 | 110 | 157 | 243 |
GRAS 157 eleetgerLakfAeelgvpfefnvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvve 243
+l ++g++L++fA+ l+++fef++ + + ++l+ + ++++p+Eal n++lql++l+de+ ++ + Lkl ksl+ ++v++ e
MDP0000420150 28 SLFTIGNQLQEFAKLLELHFEFEL-ILTPANELDESCFQLEPDEALDANFMLQLYNLFDEKPTMVN---YALKLAKSLKLQIVTLGE 110
56689******************9.7999*************************************...9**************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50985 | 12.538 | 1 | 110 | IPR005202 | Transcription factor GRAS |
| Pfam | PF03514 | 6.2E-11 | 28 | 110 | IPR005202 | Transcription factor GRAS |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 111 aa Download sequence Send to blast |
MQTIAITHVF TSSEFRKLVI LGISLLTSLF TIGNQLQEFA KLLELHFEFE LILTPANELD 60 ESCFQLEPDE ALDANFMLQL YNLFDEKPTM VNYALKLAKS LKLQIVTLGE * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5hyz_A | 3e-19 | 20 | 110 | 151 | 241 | GRAS family transcription factor containing protein, expressed |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in plant development (By similarity). Involved in environmental abiotic stress resistance. May increase the expression of stress-responsive genes (PubMed:20616154). Binds DNA in vitro (By similarity). {ECO:0000250|UniProtKB:Q53K16, ECO:0000250|UniProtKB:Q9SCR0, ECO:0000269|PubMed:20616154}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Up-regulated by drought and high salt stresses, and down-regulated by gibberellic acid (GA) treatment, but not by plant hormone abscisic acid (ABA) application in leaves. Under the salt treatment, expression is induced quickly, and it peaks at 3 hours. Under the drought treatment, the expression is not induced immediately, but reaches its maximum at 3 hours. Under the GA treatment, the expression becomes weaker within 5 hours. {ECO:0000269|PubMed:20616154}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009371590.1 | 9e-37 | PREDICTED: scarecrow-like protein 4 | ||||
| Refseq | XP_009371591.1 | 9e-37 | PREDICTED: scarecrow-like protein 4 | ||||
| Swissprot | A0A024B7I0 | 1e-29 | SCL7_POPEU; SCARECROW-LIKE protein 7 | ||||
| TrEMBL | A0A314YUF4 | 3e-33 | A0A314YUF4_PRUYE; Scarecrow-like protein 4 | ||||
| TrEMBL | M5VW27 | 6e-33 | M5VW27_PRUPE; Uncharacterized protein | ||||
| STRING | XP_009371590.1 | 3e-36 | (Pyrus x bretschneideri) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G66770.1 | 9e-19 | GRAS family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | MDP0000420150 |




