![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MDP0000462145 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 199aa MW: 21903.9 Da PI: 7.9676 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 94.6 | 4.5e-30 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien + rqvtf+kRrng+lKKA+ELSvLCdaevaviifs+++klye++s
MDP0000462145 9 KRIENATSRQVTFTKRRNGLLKKAYELSVLCDAEVAVIIFSQKDKLYEFCS 59
79***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 31.847 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.7E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.01E-33 | 3 | 80 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 8.8E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 3.16E-44 | 3 | 78 | No hit | No description |
| Pfam | PF00319 | 2.1E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 8.8E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 8.8E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 199 aa Download sequence Send to blast |
MVRGKIEMKR IENATSRQVT FTKRRNGLLK KAYELSVLCD AEVAVIIFSQ KDKLYEFCSS 60 DMQETLTRYH NYAKDEQTNK VEVEQHVQAY VEQIASILVA SGGLVGVCNG AFHQSGAKLL 120 MEHSAQEKRA SASVSYEKAG ASASASVNYW SQSIMSSEVE TELLIGPPIM RAVDRIAVLS 180 NIHQINNNAC QSSLKTIP* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6bz1_A | 7e-23 | 1 | 84 | 1 | 86 | MEF2 CHIMERA |
| 6bz1_B | 7e-23 | 1 | 84 | 1 | 86 | MEF2 CHIMERA |
| 6bz1_C | 7e-23 | 1 | 84 | 1 | 86 | MEF2 CHIMERA |
| 6bz1_D | 7e-23 | 1 | 84 | 1 | 86 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed in the shoot apical meristem (SAM) during the vegetative phase and the floral transition. After floral transition, expressed in apical meristem (AM), inflorescence meristem (IM) and floral primordia. {ECO:0000269|PubMed:21609362}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in quiescent center (QC) cells of root tips (PubMed:18162590, PubMed:21689171). Expressed at the base of the petiole of cotyledons and leaves, in flower buds, petals, sepals and abscission zone of flowers and siliques. {ECO:0000269|PubMed:18162590, ECO:0000269|PubMed:21689171}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KP164011 | 1e-136 | KP164011.1 Pyrus pyrifolia clone PpSOC1-2 SOC1-like MADS-box protein mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008376862.1 | 1e-116 | MADS-box protein AGL42-like isoform X2 | ||||
| Swissprot | Q9FIS1 | 3e-40 | AGL42_ARATH; MADS-box protein AGL42 | ||||
| TrEMBL | A0A498KPV4 | 1e-114 | A0A498KPV4_MALDO; Uncharacterized protein | ||||
| STRING | XP_009347901.1 | 9e-72 | (Pyrus x bretschneideri) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF119 | 33 | 360 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G62165.3 | 1e-42 | AGAMOUS-like 42 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | MDP0000462145 |




