PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MDP0000501518

Organism

Malus domestica

Taxonomic ID

3750

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus

Family

NAC

Protein Properties

Length: 177aa MW: 20396.1 Da PI: 8.6301

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MDP0000501518	genome	GDR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	174.9	2.3e-54	10	140	1	129
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 +ppGfrFhPtdeel+ +yL+kkv+ + ++l +vi evd++k+ePwdL++ ++ + ++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk+++ MDP0000501518 10 VPPGFRFHPTDEELLYYYLRKKVSYEAIDL-DVIGEVDLNKLEPWDLKEkcRIGSgPQNEWYFFSHKDKKYPTGTRTNRATTAGFWKATGRDKAIH 104 69**************************.9***********952444443456********************************* PP NAM 94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129 ++++ +g++ktLvfy+grap+g+ktdW+mheyrle MDP0000501518 105 LTSSKRIGMRKTLVFYTGRAPHGQKTDWIMHEYRLE 140 ********************************85 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	2.35E-55	5	144	IPR003441	NAC domain
PROSITE profile	PS51005	52.473	10	159	IPR003441	NAC domain
Pfam	PF02365	6.8E-29	11	139	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 177 aa Download sequence Send to blast
MAAGNGQLTV PPGFRFHPTD EELLYYYLRK KVSYEAIDLD VIGEVDLNKL EPWDLKEKCR 60 IGSGPQNEWY FFSHKDKKYP TGTRTNRATT AGFWKATGRD KAIHLTSSKR IGMRKTLVFY 120 TGRAPHGQKT DWIMHEYRLE DDNITADQVQ FFSSNVEKEE GVRLKKCENP FPLIDT*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	7e-48	7	139	14	142	NO APICAL MERISTEM PROTEIN
1ut4_B	7e-48	7	139	14	142	NO APICAL MERISTEM PROTEIN
1ut7_A	7e-48	7	139	14	142	NO APICAL MERISTEM PROTEIN
1ut7_B	7e-48	7	139	14	142	NO APICAL MERISTEM PROTEIN
3swm_A	6e-48	7	139	17	145	NAC domain-containing protein 19
3swm_B	6e-48	7	139	17	145	NAC domain-containing protein 19
3swm_C	6e-48	7	139	17	145	NAC domain-containing protein 19
3swm_D	6e-48	7	139	17	145	NAC domain-containing protein 19
3swp_A	6e-48	7	139	17	145	NAC domain-containing protein 19
3swp_B	6e-48	7	139	17	145	NAC domain-containing protein 19
3swp_C	6e-48	7	139	17	145	NAC domain-containing protein 19
3swp_D	6e-48	7	139	17	145	NAC domain-containing protein 19
4dul_A	7e-48	7	139	14	142	NAC domain-containing protein 19
4dul_B	7e-48	7	139	14	142	NAC domain-containing protein 19
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: First expressed at early heart stage onward in all root basal daughter cells resulting from horizontal divisions in the COL progenitors and is later maintained in these cells. Present in root stem cell daughters and accumulates in maturing root cap layers. Detectable from very early stages of lateral root development. {ECO:0000269\|PubMed:19081078, ECO:0000269\|PubMed:20197506}.
Uniprot	TISSUE SPECIFICITY: Accumulates in maturing root cap cells, in both COL and LRC cells. {ECO:0000269\|PubMed:19081078, ECO:0000269\|PubMed:20197506}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription regulator. Together with BRN1 and BRN2, regulates cellular maturation of root cap. Represses stem cell-like divisions in the root cap daughter cells, and thus promotes daughter cell fate. Inhibits expression of its positive regulator FEZ in a feedback loop for controlled switches in cell division plane. Promotes the expression of genes involved in secondary cell walls (SCW) biosynthesis. {ECO:0000269\|PubMed:19081078, ECO:0000269\|PubMed:20197506}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By FEZ in oriented-divised root cap stem cells. {ECO:0000269\|PubMed:19081078}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008383226.1	1e-110	protein SOMBRERO-like isoform X1
Refseq	XP_017190359.1	1e-110	protein SOMBRERO-like isoform X2
Refseq	XP_028965921.1	1e-110	protein SOMBRERO-like isoform X1
Refseq	XP_028965922.1	1e-110	protein SOMBRERO-like isoform X1
Refseq	XP_028965923.1	1e-110	protein SOMBRERO-like isoform X1
Swissprot	Q9MA17	4e-91	SMB_ARATH; Protein SOMBRERO
TrEMBL	A0A498IYX5	1e-108	A0A498IYX5_MALDO; Uncharacterized protein
STRING	XP_008383226.1	1e-109	(Malus domestica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF7204	34	47

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G79580.3	3e-83	NAC family protein

Link Out ? help Back to Top
Phytozome	MDP0000501518

Publications ? help Back to Top
Fendrych M, et al. Programmed cell death controlled by ANAC033/SOMBRERO determines root cap organ size in Arabidopsis. Curr. Biol., 2014. 24(9): p. 931-40 [PMID:24726156] Bennett T,van den Toorn A,Willemsen V,Scheres B Precise control of plant stem cell activity through parallel regulatory inputs. Development, 2014. 141(21): p. 4055-64 [PMID:25256342] Karve R,Suárez-Román F,Iyer-Pascuzzi AS The Transcription Factor NIN-LIKE PROTEIN7 Controls Border-Like Cell Release. Plant Physiol., 2016. 171(3): p. 2101-11 [PMID:27221617] Kamiya M, et al. Control of root cap maturation and cell detachment by BEARSKIN transcription factors in Arabidopsis. Development, 2016. 143(21): p. 4063-4072 [PMID:27803060]