![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MDP0000552812 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 124aa MW: 13934.9 Da PI: 10.4126 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 107.5 | 1.6e-33 | 28 | 101 | 54 | 128 |
NAM 54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
+ kewyf+s+rd+kyatg r+nrat++gyWkatgkd+++l+ +g+lvg++ktLvfy+grapkg+k+dWvmhe+r+
MDP0000552812 28 GGKEWYFYSQRDRKYATGLRTNRATATGYWKATGKDRPILR-RGSLVGMRKTLVFYQGRAPKGRKSDWVMHEFRV 101
679*************************************9.999****************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 33.388 | 1 | 123 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.7E-15 | 20 | 101 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 2.62E-34 | 23 | 106 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 124 aa Download sequence Send to blast |
MDDDESPPFA FLSPCAGYQE VFESACVGGK EWYFYSQRDR KYATGLRTNR ATATGYWKAT 60 GKDRPILRRG SLVGMRKTLV FYQGRAPKGR KSDWVMHEFR VEGPLGPPKI SSLKHSARIL 120 KGN* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3ulx_A | 4e-29 | 23 | 101 | 62 | 140 | Stress-induced transcription factor NAC1 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Mdo.155 | 1e-146 | leaf | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Predominantly expressed in the root tip and in lateral root initiation sites. Also detected in expanding cotyledon, and in leaf primordia. {ECO:0000269|PubMed:11114891}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Induced by auxin. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KF198123 | 1e-98 | KF198123.1 Malus hupehensis NAC domain protein (NAC88) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009336675.1 | 7e-61 | PREDICTED: NAC domain-containing protein 21/22-like | ||||
| Refseq | XP_009361751.1 | 6e-61 | PREDICTED: NAC domain-containing protein 21/22-like | ||||
| Swissprot | Q84TE6 | 6e-50 | NAC22_ARATH; NAC domain-containing protein 21/22 | ||||
| TrEMBL | A0A498JRP9 | 6e-60 | A0A498JRP9_MALDO; Uncharacterized protein | ||||
| STRING | XP_009336675.1 | 3e-60 | (Pyrus x bretschneideri) | ||||
| STRING | XP_009361751.1 | 2e-60 | (Pyrus x bretschneideri) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF10010 | 32 | 41 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G56010.1 | 2e-52 | NAC domain containing protein 1 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | MDP0000552812 |




