![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MDP0000558105 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 46aa MW: 5190.92 Da PI: 8.9259 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 34.5 | 4.8e-11 | 13 | 44 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32
+g+W+++Ed++l+d+++++G g+W+t ++ g
MDP0000558105 13 KGAWSKQEDLKLIDYIRKHGEGCWRTLPQAAG 44
79************************998776 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 7.1E-13 | 4 | 42 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 1.87E-8 | 7 | 42 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 14.353 | 8 | 45 | IPR017930 | Myb domain |
| Pfam | PF00249 | 6.5E-9 | 13 | 44 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 3.58E-5 | 15 | 37 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 46 aa Download sequence Send to blast |
MRKPCCDKQD TNKGAWSKQE DLKLIDYIRK HGEGCWRTLP QAAGN* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Mdo.15876 | 8e-70 | leaf | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in roots, stems, flower buds, and siliques. {ECO:0000269|PubMed:9839469}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By ethylene, asbscisic acid (ABA), auxin (IAA), and Pseudomonas syringae pv. phaseolica. {ECO:0000269|PubMed:9839469}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KT159234 | 4e-62 | KT159234.1 Prunus persica R2R3-MYB transcription factor (MYB18) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_017192216.1 | 1e-25 | transcription repressor MYB6-like | ||||
| Swissprot | Q38851 | 6e-18 | MYB6_ARATH; Transcription repressor MYB6 | ||||
| TrEMBL | A0A498IAH4 | 3e-24 | A0A498IAH4_MALDO; Uncharacterized protein | ||||
| STRING | EMJ25070 | 3e-24 | (Prunus persica) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G09460.1 | 2e-20 | myb domain protein 6 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | MDP0000558105 |




