![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MDP0000598428 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 81aa MW: 9316 Da PI: 10.505 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 98.6 | 3.9e-31 | 4 | 60 | 3 | 59 |
-SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
Dg++WrKYGqK+vkg+++prsYYr s +C+v+k+ver ++dpk++++tYeg+Hnh+
MDP0000598428 4 DGFRWRKYGQKVVKGNPYPRSYYRXXSLKCNVRKHVERVSDDPKAFITTYEGKHNHD 60
9*******************************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50811 | 32.535 | 1 | 62 | IPR003657 | WRKY domain |
| SMART | SM00774 | 5.6E-32 | 2 | 61 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 1.19E-25 | 2 | 62 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 7.1E-30 | 3 | 62 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 4.7E-25 | 4 | 60 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 81 aa Download sequence Send to blast |
MTGDGFRWRK YGQKVVKGNP YPRSYYRXXS LKCNVRKHVE RVSDDPKAFI TTYEGKHNHD 60 IPLRNAHTGA SDKDTTKQKP * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 3e-30 | 1 | 62 | 16 | 77 | Probable WRKY transcription factor 4 |
| 2lex_A | 3e-30 | 1 | 62 | 16 | 77 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Mdo.11654 | 3e-98 | stem | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: In young, mature and senescent leaves. {ECO:0000269|PubMed:11722756}. | |||||
| Uniprot | TISSUE SPECIFICITY: In young, mature and senescent leaves. {ECO:0000269|PubMed:11722756}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| UniProt | Transcription factor that binds specifically to the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element. Has a positive role in resistance to necrotrophic pathogens (e.g. Botrytis cinerea), but a negative effect on plant resistance to biotrophic pathogens (e.g. Pseudomonas syringae). {ECO:0000269|PubMed:18570649, ECO:0000269|PubMed:22219184}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By biotic and abiotic stresses such as pathogen infection (e.g. Botrytis cinerea and Pseudomonas syringae), salicylic acid (SA), jasmonic acid (JA), ethylene (ACC), liquid infiltration or spraying, and strongly during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756, ECO:0000269|PubMed:18570649}. | |||||
| UniProt | INDUCTION: By salicylic acid and during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KJ020109 | 7e-78 | KJ020109.1 Malus hybrid cultivar TTG2 protein (TTG2) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_028945363.1 | 4e-50 | WRKY transcription factor 44 isoform X2 | ||||
| Swissprot | Q9XI90 | 8e-28 | WRKY4_ARATH; Probable WRKY transcription factor 4 | ||||
| Swissprot | Q9ZQ70 | 6e-28 | WRKY3_ARATH; Probable WRKY transcription factor 3 | ||||
| TrEMBL | A0A498IES4 | 2e-46 | A0A498IES4_MALDO; Uncharacterized protein | ||||
| STRING | XP_009342013.1 | 2e-49 | (Pyrus x bretschneideri) | ||||
| STRING | XP_009342023.1 | 2e-47 | (Pyrus x bretschneideri) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF7118 | 34 | 49 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G03340.1 | 2e-30 | WRKY DNA-binding protein 3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | MDP0000598428 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




