![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MDP0000605482 | ||||||||
| Common Name | MADS91 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 150aa MW: 17191.8 Da PI: 9.806 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 100.8 | 5.2e-32 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs++gklye++s
MDP0000605482 9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCS 59
79***********************************************96 PP
| |||||||
| 2 | K-box | 68.9 | 1.6e-23 | 80 | 143 | 6 | 69 |
K-box 6 gksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskK 69
+++ +++ es+++e+ kLk + e+Lqr+qR+llGe+L++L+ keL+qLe+qLe slk++R +K
MDP0000605482 80 QVNIPAKELESSYREYMKLKGRCESLQRTQRNLLGEELGPLNTKELEQLERQLEASLKQVRFTK 143
555678899****************************************************887 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.1E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 33.165 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 2.75E-43 | 2 | 79 | No hit | No description |
| SuperFamily | SSF55455 | 2.88E-33 | 2 | 76 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.0E-33 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 6.3E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.0E-33 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.0E-33 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 3.3E-18 | 87 | 143 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 10.994 | 88 | 149 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 150 aa Download sequence Send to blast |
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIVFSN RGKLYEFCSS 60 PSILQTVDRY QKCSYGAVDQ VNIPAKELES SYREYMKLKG RCESLQRTQR NLLGEELGPL 120 NTKELEQLER QLEASLKQVR FTKGPFEIA* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4ox0_A | 3e-20 | 75 | 146 | 1 | 75 | Developmental protein SEPALLATA 3 |
| 4ox0_B | 3e-20 | 75 | 146 | 1 | 75 | Developmental protein SEPALLATA 3 |
| 4ox0_C | 3e-20 | 75 | 146 | 1 | 75 | Developmental protein SEPALLATA 3 |
| 4ox0_D | 3e-20 | 75 | 146 | 1 | 75 | Developmental protein SEPALLATA 3 |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Mdo.2953 | 0.0 | bud| fruit | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed early during flower development. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed mainly in carpels, and weakly in stamens. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. Functions with SEPALLATA2/AGL4 and SEPALLATA3/AGL9 to ensure proper development of petals, stamens and carpels, and to prevent the indeterminate growth of the flower meristem. Forms a heterodimer via the K-box domain with AGAMOUS, that could be involved in genes regulation during floral meristem development. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KC415236 | 0.0 | KC415236.1 Malus domestica cultivar Fuji Beni Shogun MADS9-2 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | NP_001315825.1 | 2e-96 | developmental protein SEPALLATA 1-like | ||||
| Swissprot | P29382 | 2e-82 | SEP1_ARATH; Developmental protein SEPALLATA 1 | ||||
| TrEMBL | D9ZJ48 | 3e-96 | D9ZJ48_MALDO; MADS domain class transcription factor | ||||
| STRING | XP_008365428.1 | 3e-98 | (Malus domestica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF229 | 32 | 178 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G15800.1 | 8e-85 | MIKC_MADS family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | MDP0000605482 |




