PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000626215
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 97aa    MW: 10814.7 Da    PI: 9.0697
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000626215genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM514.9e-161869152
            NAM  1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvk 52
                   l++G+rFhPt eel+++yLk k++g +  ++++i+e++i+++ePw+Lp+ ++
  MDP0000626215 18 LQVGYRFHPTKEELISHYLKLKLRGMDSLVSDAIREINICNYEPWELPALYE 69
                   578************************99999***************96433 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019413.53E-16868IPR003441NAC domain
PROSITE profilePS5100517.3641896IPR003441NAC domain
PfamPF023651.4E-62062IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 97 aa     Download sequence    Send to blast
MASNGIRFTR VEVGGMLLQV GYRFHPTKEE LISHYLKLKL RGMDSLVSDA IREINICNYE  60
PWELPALYEA SSKPEAGGVL VVKLKSIWLG SKGFLF*
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator activated by proteolytic cleavage through regulated intramembrane proteolysis (RIP). Involved in salt stress response during seed germination and seedling growth. Binds the auxin-responsive IAA30 gene promoter and may serve as a molecular link that interconnects a developmental feedback loop of auxin signaling with a salt signal transduction pathway during seed germination (PubMed:21450938). {ECO:0000269|PubMed:21450938}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By salt stress and abscisic acid (ABA) in roots. {ECO:0000269|PubMed:21450938}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009376040.11e-35PREDICTED: NAC domain-containing protein 4-like isoform X1
RefseqXP_009376041.11e-35PREDICTED: NAC domain-containing protein 4-like isoform X2
RefseqXP_009376042.11e-35PREDICTED: NAC domain-containing protein 4-like isoform X3
SwissprotQ9M1265e-14NAC69_ARATH; NAC domain-containing protein 69
TrEMBLA0A498JJR85e-27A0A498JJR8_MALDO; Uncharacterized protein
STRINGXP_008347198.11e-41(Malus domestica)
STRINGXP_008376275.16e-40(Malus domestica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13478522
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G01550.12e-16NAC domain containing protein 69
Publications ? help Back to Top
  1. Liang M, et al.
    Subcellular Distribution of NTL Transcription Factors in Arabidopsis thaliana.
    Traffic, 2015. 16(10): p. 1062-74
    [PMID:26201836]
  2. He L, et al.
    Arabidopsis ANAC069 binds to C[A/G]CG[T/G] sequences to negatively regulate salt and osmotic stress tolerance.
    Plant Mol. Biol., 2017. 93(4-5): p. 369-387
    [PMID:27975189]