![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MDP0000682805 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
| Family | NF-YA | ||||||||
| Protein Properties | Length: 112aa MW: 12310.7 Da PI: 10.5822 | ||||||||
| Description | NF-YA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | CBFB_NFYA | 104.8 | 7.6e-33 | 16 | 72 | 1 | 58 |
CBFB_NFYA 1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58
+ep++VNaKQy++Il+RRq+Rak+e+e+k k+rkpylheSRh+hAlrR+Rg+gGrF
MDP0000682805 16 EEPVFVNAKQYHGILRRRQSRAKAESENKA-LKNRKPYLHESRHQHALRRARGCGGRF 72
69***************************9.9*************************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00521 | 5.9E-36 | 14 | 75 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE profile | PS51152 | 37.071 | 15 | 75 | IPR001289 | Nuclear transcription factor Y subunit A |
| Pfam | PF02045 | 5.6E-28 | 17 | 72 | IPR001289 | Nuclear transcription factor Y subunit A |
| PRINTS | PR00616 | 3.0E-24 | 18 | 40 | IPR001289 | Nuclear transcription factor Y subunit A |
| PROSITE pattern | PS00686 | 0 | 20 | 40 | IPR018362 | CCAAT-binding factor, conserved site |
| PRINTS | PR00616 | 3.0E-24 | 49 | 72 | IPR001289 | Nuclear transcription factor Y subunit A |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0016602 | Cellular Component | CCAAT-binding factor complex | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 112 aa Download sequence Send to blast |
MGIQQAGVPL PSDAVEEPVF VNAKQYHGIL RRRQSRAKAE SENKALKNRK PYLHESRHQH 60 ALRRARGCGG RFLNAKKNGN QPDEMTSGDK SQSNINLNTD KNELASSDGT S* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_A | 2e-22 | 15 | 78 | 1 | 64 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008383405.1 | 4e-77 | nuclear transcription factor Y subunit A-7-like | ||||
| Swissprot | Q84JP1 | 5e-49 | NFYA7_ARATH; Nuclear transcription factor Y subunit A-7 | ||||
| TrEMBL | A0A498IXT7 | 6e-75 | A0A498IXT7_MALDO; Uncharacterized protein | ||||
| STRING | XP_008383405.1 | 2e-76 | (Malus domestica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF5379 | 33 | 55 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G30500.1 | 2e-51 | nuclear factor Y, subunit A7 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | MDP0000682805 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




