![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MDP0000756254 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 64aa MW: 7385.64 Da PI: 9.3075 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 56.6 | 5.1e-18 | 6 | 42 | 23 | 59 |
EEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 23 sYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
sYYrCt+++C+vkk+v+r ++d+++v++tYeg Hnh+
MDP0000756254 6 SYYRCTHHTCNVKKQVQRLSKDTSIVVTTYEGIHNHP 42
9***********************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF118290 | 1.44E-14 | 5 | 43 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 15.135 | 6 | 44 | IPR003657 | WRKY domain |
| SMART | SM00774 | 4.9E-8 | 6 | 43 | IPR003657 | WRKY domain |
| Gene3D | G3DSA:2.20.25.80 | 4.9E-15 | 6 | 42 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 4.8E-13 | 6 | 42 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 64 aa Download sequence Send to blast |
MILSGSYYRC THHTCNVKKQ VQRLSKDTSI VVTTYEGIHN HPCEKLMETL TPLLKQMQFL 60 SRF* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | JF708959 | 2e-52 | JF708959.1 Dimocarpus longan WRKY transcription factor 23-1 mRNA, partial cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021279718.1 | 1e-37 | probable WRKY transcription factor 43 | ||||
| Swissprot | Q8VWQ4 | 6e-32 | WRK56_ARATH; Probable WRKY transcription factor 56 | ||||
| Swissprot | Q9FFS3 | 5e-32 | WRK24_ARATH; Probable WRKY transcription factor 24 | ||||
| TrEMBL | A0A059C012 | 1e-35 | A0A059C012_EUCGR; Uncharacterized protein | ||||
| STRING | XP_008344897.1 | 1e-36 | (Malus domestica) | ||||
| STRING | XP_010055075.1 | 2e-36 | (Eucalyptus grandis) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF3227 | 34 | 71 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G41570.1 | 2e-34 | WRKY DNA-binding protein 24 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | MDP0000756254 |




