![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MDP0000788655 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 56aa MW: 6439.42 Da PI: 4.2322 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 64.2 | 3.9e-20 | 6 | 52 | 1 | 48 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp 48
lppGfrFhPtdeelv +yL +k++g+++el e+i+evd+yk+ePwd+p
MDP0000788655 6 LPPGFRFHPTDEELVAYYLDRKINGRTIEL-EIIPEVDLYKCEPWDFP 52
79****************************.99*************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 5.75E-20 | 4 | 52 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 21.577 | 6 | 55 | IPR003441 | NAC domain |
| Pfam | PF02365 | 8.8E-10 | 7 | 49 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 56 aa Download sequence Send to blast |
MAPISLPPGF RFHPTDEELV AYYLDRKING RTIELEIIPE VDLYKCEPWD FPVCT* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3ulx_A | 7e-16 | 2 | 52 | 11 | 61 | Stress-induced transcription factor NAC1 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in a few sieve element cells before enucleation and in phloem-pole pericycle cells. {ECO:0000269|PubMed:25081480}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC045, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AM465684 | 4e-41 | AM465684.2 Vitis vinifera contig VV78X155772.10, whole genome shotgun sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_009104136.1 | 2e-30 | PREDICTED: NAC domain-containing protein 86-like | ||||
| Swissprot | Q9FFI5 | 2e-28 | NAC86_ARATH; NAC domain-containing protein 86 | ||||
| TrEMBL | A0A397YME5 | 6e-29 | A0A397YME5_BRACM; Uncharacterized protein | ||||
| TrEMBL | A0A3P6BE60 | 6e-29 | A0A3P6BE60_BRACM; Uncharacterized protein | ||||
| TrEMBL | M4CGK2 | 4e-29 | M4CGK2_BRARP; Uncharacterized protein | ||||
| STRING | Bra003335.1-P | 7e-30 | (Brassica rapa) | ||||
| STRING | XP_008371963.1 | 1e-29 | (Malus domestica) | ||||
| STRING | XP_010480185.1 | 1e-29 | (Camelina sativa) | ||||
| STRING | XP_010480187.1 | 1e-29 | (Camelina sativa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF11433 | 17 | 39 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G65910.1 | 1e-32 | NAC domain containing protein 28 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | MDP0000788655 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




