PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MDP0000792088

Organism

Malus domestica

Taxonomic ID

3750

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus

Family

WRKY

Protein Properties

Length: 227aa MW: 25551 Da PI: 10.1491

Description

WRKY family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MDP0000792088	genome	GDR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRKY	35.4	2.2e-11	111	137	1	27
---SS-EEEEEEE--TT-SS-EEEEEE CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrC 27 ldDgy+WrKYGqK vk+++fp C MDP0000792088 111 LDDGYRWRKYGQKAVKNNKFPSVISSC 137 59******************9765555 PP
2	WRKY	52.7	8.5e-17	167	205	21	59
-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 21 prsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 + sYYrCt++gC+vkk+v+r ++d+ vv++tYeg H h+ MDP0000792088 167 ALSYYRCTHHGCNVKKQVQRLTKDEGVVVTTYEGMHSHP 205 679***********************************7 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:2.20.25.80	9.4E-31	96	131	IPR003657	WRKY domain
SuperFamily	SSF118290	7.59E-10	103	141	IPR003657	WRKY domain
PROSITE profile	PS50811	23.227	106	207	IPR003657	WRKY domain
SMART	SM00774	2.5E-30	111	206	IPR003657	WRKY domain
Pfam	PF03106	9.2E-8	112	139	IPR003657	WRKY domain
Pfam	PF03106	2.3E-12	167	205	IPR003657	WRKY domain
Gene3D	G3DSA:2.20.25.80	9.4E-31	168	205	IPR003657	WRKY domain
SuperFamily	SSF118290	1.57E-13	169	206	IPR003657	WRKY domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 227 aa Download sequence Send to blast
MENYPTFFSS STAPAPSPLS LNMGNPAHHV YNSNDPRQFQ NRKSSNGFLG LMSEMEASNN 60 MIKNNFSSQG KSFGGSESGE ATVRLGMKKG DQKKIRKPRY AFQTRSQVDI LDDGYRWRKY 120 GQKAVKNNKF PSVISSCITR SASAVSLFFV LQLLLLRMNL TLEKDGALSY YRCTHHGCNV 180 KKQVQRLTKD EGVVVTTYEG MHSHPIEKST DNFEHILSQM KIYTPF*

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Mdo.30252	1e-176	root

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KF887982	1e-168	KF887982.1 Malus baccata WRKY75 (WRKY75) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008389898.1	1e-135	probable WRKY transcription factor 75
Swissprot	Q9FYA2	9e-49	WRK75_ARATH; Probable WRKY transcription factor 75
TrEMBL	A0A498IEB5	1e-134	A0A498IEB5_MALDO; Uncharacterized protein
STRING	XP_008389898.1	1e-135	(Malus domestica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1156	34	110

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G13080.1	9e-51	WRKY DNA-binding protein 75

Link Out ? help Back to Top
Phytozome	MDP0000792088

Publications ? help Back to Top
Brand LH,Kirchler T,Hummel S,Chaban C,Wanke D DPI-ELISA: a fast and versatile method to specify the binding of plant transcription factors to DNA in vitro. Plant Methods, 2010. 6: p. 25 [PMID:21108821] Xu L, et al. Overexpression of GbWRKY1 positively regulates the Pi starvation response by alteration of auxin sensitivity in Arabidopsis. Plant Cell Rep., 2012. 31(12): p. 2177-88 [PMID:22890372] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schmiesing A,Emonet A,Gouhier-Darimont C,Reymond P Arabidopsis MYC Transcription Factors Are the Target of Hormonal Salicylic Acid/Jasmonic Acid Cross Talk in Response to Pieris brassicae Egg Extract. Plant Physiol., 2016. 170(4): p. 2432-43 [PMID:26884488] Velasco VM, et al. Acclimation of the crucifer Eutrema salsugineum to phosphate limitation is associated with constitutively high expression of phosphate-starvation genes. Plant Cell Environ., 2016. 39(8): p. 1818-34 [PMID:27038434] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhang H,Huang L,Hong Y,Song F BOTRYTIS-INDUCED KINASE1, a plasma membrane-localized receptor-like protein kinase, is a negative regulator of phosphate homeostasis in Arabidopsis thaliana. BMC Plant Biol., 2016. 16(1): p. 152 [PMID:27389008] Zhang S, et al. The Arabidopsis Mitochondrial Protease FtSH4 Is Involved in Leaf Senescence via Regulation of WRKY-Dependent Salicylic Acid Accumulation and Signaling. Plant Physiol., 2017. 173(4): p. 2294-2307 [PMID:28250067] Guo P, et al. A Tripartite Amplification Loop Involving the Transcription Factor WRKY75, Salicylic Acid, and Reactive Oxygen Species Accelerates Leaf Senescence. Plant Cell, 2017. 29(11): p. 2854-2870 [PMID:29061866] Zhang L,Chen L,Yu D Transcription Factor WRKY75 Interacts with DELLA Proteins to Affect Flowering. Plant Physiol., 2018. 176(1): p. 790-803 [PMID:29133369]