![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | MDP0000834768 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 77aa MW: 8912.59 Da PI: 10.1498 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 33.7 | 4.6e-11 | 10 | 52 | 2 | 44 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
+i n+ r+ t+ k + g +KK +E+ LCd+ + i++s++
MDP0000834768 10 FIINNVSRKATLRKMKRGFMKKMYEINKLCDVPTCAIMYSPDE 52
788999**********************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 12.755 | 1 | 49 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 4.71E-17 | 1 | 72 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.0E-7 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.8E-6 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00266 | 1.50E-20 | 4 | 75 | No hit | No description |
| Pfam | PF00319 | 6.4E-11 | 10 | 52 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.8E-6 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.8E-6 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 77 aa Download sequence Send to blast |
MNIRKVKLAF IINNVSRKAT LRKMKRGFMK KMYEINKLCD VPTCAIMYSP DESQPEVWPD 60 SSGVQRLIEQ FALLQY* |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in the central cell of the female gametophyte and in early endosperm. Also detected in ovaries, young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269|PubMed:16798889}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_008364016.2 | 9e-33 | agamous-like MADS-box protein AGL80 | ||||
| Swissprot | Q9FJK3 | 8e-18 | AGL80_ARATH; Agamous-like MADS-box protein AGL80 | ||||
| TrEMBL | A0A498IJ48 | 5e-29 | A0A498IJ48_MALDO; Uncharacterized protein | ||||
| STRING | XP_009335560.1 | 1e-40 | (Pyrus x bretschneideri) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF452 | 33 | 154 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G05860.2 | 8e-21 | M-type_MADS family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | MDP0000834768 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




