PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000834768
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family M-type_MADS
Protein Properties Length: 77aa    MW: 8912.59 Da    PI: 10.1498
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000834768genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF33.74.6e-111052244
                   ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTS CS
         SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstg 44
                   +i n+  r+ t+ k + g +KK +E+  LCd+  + i++s++ 
  MDP0000834768 10 FIINNVSRKATLRKMKRGFMKKMYEINKLCDVPTCAIMYSPDE 52
                   788999**********************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006612.755149IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.71E-17172IPR002100Transcription factor, MADS-box
SMARTSM004321.0E-7160IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-6323IPR002100Transcription factor, MADS-box
CDDcd002661.50E-20475No hitNo description
PfamPF003196.4E-111052IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-62338IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-63859IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 77 aa     Download sequence    Send to blast
MNIRKVKLAF IINNVSRKAT LRKMKRGFMK KMYEINKLCD VPTCAIMYSP DESQPEVWPD  60
SSGVQRLIEQ FALLQY*
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in the central cell of the female gametophyte and in early endosperm. Also detected in ovaries, young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269|PubMed:16798889}.
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008364016.29e-33agamous-like MADS-box protein AGL80
SwissprotQ9FJK38e-18AGL80_ARATH; Agamous-like MADS-box protein AGL80
TrEMBLA0A498IJ485e-29A0A498IJ48_MALDO; Uncharacterized protein
STRINGXP_009335560.11e-40(Pyrus x bretschneideri)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF45233154
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.28e-21M-type_MADS family protein
Publications ? help Back to Top
  1. Zhang S, et al.
    FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development.
    Plant Physiol., 2018. 177(1): p. 285-299
    [PMID:29523711]