PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

MDP0000899251

Organism

Malus domestica

Taxonomic ID

3750

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus

Family

MYB_related

Protein Properties

Length: 57aa MW: 6273.32 Da PI: 10.8185

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MDP0000899251	genome	GDR	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	43.6	6.8e-14	14	56	1	43
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksr 43 rg+WT+ Ed+ll+++ + +G g+W++ ++ g+ R++k+c++r MDP0000899251 14 RGSWTAREDKLLIQYMNSHGEGRWSSLPKNAGLLRCGKSCRLR 56 89****************************99*****98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	2.2E-16	5	56	IPR009057	Homeodomain-like
SuperFamily	SSF46689	3.01E-11	8	56	IPR009057	Homeodomain-like
PROSITE profile	PS51294	15.511	9	56	IPR017930	Myb domain
Pfam	PF00249	1.8E-12	14	56	IPR001005	SANT/Myb domain
CDD	cd00167	1.14E-8	16	56	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 57 aa Download sequence Send to blast
MGRAPCCSKV GLHRGSWTAR EDKLLIQYMN SHGEGRWSSL PKNAGLLRCG KSCRLR*

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor postulated to regulate the biosynthetic pathway of a flavonoid-derived pigment in certain floral tissues.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_018500216.1	7e-32	PREDICTED: transcription repressor MYB6-like
Swissprot	P27898	8e-24	MYBP_MAIZE; Myb-related protein P
TrEMBL	A0A251P7N1	2e-27	A0A251P7N1_PRUPE; Uncharacterized protein
TrEMBL	A0A2P5FHK8	4e-27	A0A2P5FHK8_TREOI; MYB transcription factor
TrEMBL	M5WPN0	1e-27	M5WPN0_PRUPE; Uncharacterized protein
STRING	XP_009359589.1	8e-32	(Pyrus x bretschneideri)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31	34	817

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT5G49330.1	2e-25	myb domain protein 111

Link Out ? help Back to Top
Phytozome	MDP0000899251

Publications ? help Back to Top
Robbins ML,Sekhon RS,Meeley R,Chopra S A Mutator transposon insertion is associated with ectopic expression of a tandemly repeated multicopy Myb gene pericarp color1 of maize. Genetics, 2008. 178(4): p. 1859-74 [PMID:18430921] Sidorenko L,Chandler V RNA-dependent RNA polymerase is required for enhancer-mediated transcriptional silencing associated with paramutation at the maize p1 gene. Genetics, 2008. 180(4): p. 1983-93 [PMID:18845841] Robbins ML,Wang P,Sekhon RS,Chopra S Gene structure induced epigenetic modifications of pericarp color1 alleles of maize result in tissue-specific mosaicism. PLoS ONE, 2009. 4(12): p. e8231 [PMID:20011605] Rhee Y,Sekhon RS,Chopra S,Kaeppler S Tissue culture-induced novel epialleles of a Myb transcription factor encoded by pericarp color1 in maize. Genetics, 2010. 186(3): p. 843-55 [PMID:20823340] Morohashi K, et al. A genome-wide regulatory framework identifies maize pericarp color1 controlled genes. Plant Cell, 2012. 24(7): p. 2745-64 [PMID:22822204]